Detailed information on CNT30595486


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690874Oryza meridionalisOryza sativa14.927.2197.5983forward
CNT30676253Oryza meridionalisSetaria viridis21.1848.7683.9118forward
CNT30349851Oryza meridionalisEragrostis tef10.0521.7187.556reverse complement
CNT30100513Oryza meridionalisOryza rufipogon46.6846.5193.46260forward
CNT30575151Oryza meridionalisOryza barthii45.635.9896.46254forward

Expression of CNT30595486

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MHTCNYGEKVIKHINRSLLIRSDRSSQLTASLVC*

>peptide 2 (48 aa)
PCLTPFISKKKKKGNQIFCVQHKRTYLILSADTELLMYSNTKYKRRRR*

>peptide 3 (39 aa)
AVPYALHFKEEKKRKPNFLCAAQTHLFNTQCGYRITNVQ*

>peptide 4 (92 aa)
MLIDRDQYWSAACFLASFFSWCSWKANPAAPSAAAELLEVLVVLLLLVVVHHAGALLLPVLLVVEQVVMLLLLSHGYSLTNLSFLQTELVAGT

Sequence

>CNT30595486
GCCGTGCCTTACGCCCTTCATTTCAAAGAAGAAAAAAAAAGGAAACCAAATTTTCTGTGTGCAGCACAAACGCACTTATTTAATACTCAGTGCGGATACA
GAATTACTAATGTACAGTAACACGAAGTACAAGCGACGACGACGATGACGAACAAGAAGAAGCAAAGCCATCAACCAGATGCATACATGTAATTATGGGG
AAAAAGTAATTAAGCATATAAATCGTTCGTTGTTAATTCGTTCCGATCGATCGAGCCAGCTGACAGCTAGCTTAGTATGTTGATCGATCGGGATCAGTAC
TGGTCGGCGGCGTGCTTCTTGGCGTCCTTCTTCTCGTGGTGCTCGTGGAAGGCGAACCCGGCGGCGCCCAGCGCGGCCGCCGAGCTGCTCGAGGTGCTTG
TGGTGCTTCTTCTCCTTGTCGTAGTCCACCACGCCGGAGCTCTCCTCCTCCCCGTCCTTCTTGTGGTGGAACAGGTGGTGATGCTTCTTCTCCTCAGCCA
TGGCTACTCACTGACTAATCTTAGCTTCCTTCAGACAGAGTTGGTTGCTGGTACGTG