Detailed information on CNT30595456


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8VZC0|UXS1_ARATH, E-value = 2e-78

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522345Oryza meridionalisSetaria italica70.8853.8785.89404forward
CNT30530404Oryza meridionalisEucalyptus grandis41.466.4887.71236forward
CNT30316147Oryza meridionalisCorylus avellana51.9339.7384.46296forward
CNT30703138Oryza meridionalisQuercus lobata61.466.7981.71350forward
CNT30500451Oryza meridionalisCoffea canephora42.4622.6881.4242forward
CNT30277485Oryza meridionalisChenopodium quinoa26.8417.9480.39153forward
CNT3021362Oryza meridionalisCitrullus lanatus31.9327.9681.32182forward
CNT30727603Oryza meridionalisCorchorus capsularis27.8932.1982.39159forward
CNT3068683Oryza meridionalisQuercus suber61.471.1482.57350forward
CNT30524728Oryza meridionalisPhaseolus vulgaris56.6759.8179.57323forward
CNT30504810Oryza meridionalisNicotiana attenuata20.3517.8285.34116forward
CNT30636701Oryza meridionalisCapsicum annuum25.0934.7985.31143forward
CNT3098150Oryza meridionalisSolanum tuberosum28.2532.8680.12161forward
CNT30182233Oryza meridionalisSecale cereale74.5668.3394.59425forward
CNT30289293Oryza meridionalisTriticum aestivum22.6342.4386.05129forward
CNT30222279Oryza meridionalisHordeum vulgare52.9810094.04302forward
CNT30590847Oryza meridionalisMusa acuminata58.4272.8781.68333forward
CNT30539234Oryza meridionalisBrassica napus34.5621.5381.73197forward
CNT30510868Oryza meridionalisSolanum lycopersicum30.3583.1780.92173forward
CNT30143812Oryza meridionalisMedicago truncatula30.5314.0782.18174forward
CNT30246244Oryza meridionalisAvena sativa74.5652.2193.88425forward
CNT30662162Oryza meridionalisTriticum dicoccoides12.1120.5494.269forward
CNT30261302Oryza meridionalisBrassica rapa34.5638.181.73197forward
CNT30457014Oryza meridionalisSaccharum spontaneum75.4456.2893.02430forward
CNT30134072Oryza meridionalisLolium perenne74.5658.5492425forward
CNT3066796Oryza meridionalisLeersia perrieri66.6797.6995.26380forward
CNT30653881Oryza meridionalisRosa chinensis47.0225.0981.34268forward
CNT30718631Oryza meridionalisMalus domestica golden58.4258.0180.18333forward
CNT30338563Oryza meridionalisEragrostis tef72.6310091.3414forward
CNT30477892Oryza meridionalisArabidopsis halleri55.7929.7279.56318forward
CNT30363710Oryza meridionalisSorghum bicolor40.1839.0187.77229forward
CNT30358465Oryza meridionalisLactuca sativa36.3219.8581.64207forward
CNT30424172Oryza meridionalisPapaver somniferum31.0525.3684.18177forward
CNT30570592Oryza meridionalisVitis vinifera17.7231.2784.16101forward
CNT3054595Oryza meridionalisAmborella trichopoda26.6773.4382.24152forward
CNT30105598Oryza meridionalisOryza longistaminata46.4938.4687.55265forward
CNT30325711Oryza meridionalisAsparagus officinalis45.0980.5684.82257forward
CNT30102778Oryza meridionalisOryza rufipogon1022.5389.4757forward
CNT30574680Oryza meridionalisOryza barthii41.0525.5587.18234forward
CNT30580107Oryza meridionalisEchinochloa crusgalli77.1984.7892.95440forward
CNT30497454Oryza meridionalisDigitaria exilis64.7499.1992.41369forward
CNT30115589Oryza meridionalisOryza nivara41.0516.487.18234forward
CNT30594668Oryza meridionalisEragrostis curvula55.6194.0792.43317forward
CNT30603506Oryza meridionalisOryza punctata68.2577.4983.55389forward
CNT30174824Oryza meridionalisVigna angularis68.9541.3780.41393forward
CNT30550386Oryza meridionalisOryza brachyantha32.2866.9188.59184forward
CNT30336663Oryza meridionalisCynara cardunculus27.0232.9885.06154forward
CNT30723923Oryza meridionalisLupinus angustifolius34.3995.6181.12196forward
CNT3064271Oryza meridionalisSelaginella moellendorffii47.1948.9181.78269forward

Expression of CNT30595456

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MRCARRRRRAGGGRGRGRTGRGRRGRGGGGRRRRRSGRR

>peptide 2 (41 aa)
MRGTRGDRSGPPRAGWARRHRGGAARTWGSGGGARRCPSSR*

>peptide 3 (98 aa)
MGSTTSWRSSSNLGFRRWCATLSFLPVKKLSTTITLSPCSSSLSTRWLPTNPAPPVTTTRRGGGRNPGGTPDADEVCEAKEKSGRRSGTWEDGEREKR*

Sequence

>CNT30595456
ACCAATAGGATTAACATGCCCCCAGTAAGTCTCCTTCTGTGGATGTTCAAGTGGATCTCCATAAACTTCACTTGTGCTAGTTAGCAAGAACCTTGCACCA
ATTCGCTTTGCCAGACCCAACATATTCAAGGTTCCCATGACATTGGATATGATCGTCTTGATGGGGTTGTACTTGTAGTGCACGGGGGATGCGGGGCACG
CGAGGTGATAGATCCGGTCCACCTCGAGCAGGATGGGCTCGACGACATCGTGGCGGAGCAGCTCGAACCTGGGGTTCCGGAGGTGGTGCGCGACGTTGTC
CTTCCTCCCGGTGAAGAAGTTGTCCACCACGATCACGCTGTCCCCTTGCTCCAGCAGCCTGTCGACGAGGTGGCTGCCGACGAACCCGGCCCCGCCGGTG
ACGACGACGCGGCGCGGCGGCGGGCGGAACCCGGGGGGCACGCCCGACGCCGATGAGGTGTGCGAGGCGAAGGAGAAGAGCGGGCGGCGGTCGGGGACGT
GGGAGGACGGGGAGAGGGAGAAGAGGTAGGGGCGGAGGAGGAAGAAGGAGGAGGCGATCAGGGCGCCGAG