Detailed information on CNT30595443


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690094Oryza meridionalisOryza sativa100.7663.5291.69397forward
CNT30552014Oryza meridionalisOryza glaberrima86.0483.9191.45339forward
CNT30369383Oryza meridionalisOryza glumipatula95.9491.9790.74378forward
CNT30575057Oryza meridionalisOryza barthii87.0686.1887.17343forward
CNT30115607Oryza meridionalisOryza nivara89.5984.6590.93353forward
CNT30603472Oryza meridionalisOryza punctata41.8842.9792.73165forward

Expression of CNT30595443

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MVEDHLISLPSDELIPSLCVAYAFLCCGGEEQWLLRLVVYIAAG

Sequence

>CNT30595443
CGGGTACATCACATCACACAAATTCATACGTTGATACACGCATAGTCGCCGAAGCGACCAGCTGCTTAATTAATCGATAACACACGGGCTTAATTCAGCA
ATAATCAGCACACACACAAACCACGCATACGGTGATTTTTATTGTGGACTAATTAAGGTAGGTGACTCGCCGGCGGCGAGTGGTGGTCGGTTGCTTCATG
CATGACTTCACTTGCCGCACTTGCAGTCGGTGCAGGAGCAGCTGTTGCCGCACTTGTCCGACATGGTCGAAGATCACTTAATTAGCTTACCGAGTGATGA
ATTAATTCCTTCCTTGTGTGTTGCTTATGCTTTCTTGTGCTGCGGTGGTGAGGAGCAATGGCTGCTTCGGCTGGTGGTATATATAGCGGCTGGA