Detailed information on CNT305897


BLAST search results

BLAST vs Swiss-Prot:
sp|O65107|PSAN_MAIZE, E-value = 1e-36

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697529Zea maysOryza sativa23.2326.2189.81108forward
CNT30676742Zea maysSetaria viridis38.7124.9395180forward
CNT30523702Zea maysSetaria italica25.3823.694.07118forward
CNT30137831Zea maysLolium perenne2021.5891.493forward
CNT30349482Zea maysEragrostis tef14.8429.1194.269forward
CNT30367427Zea maysSorghum bicolor28.3933.3396.97132forward
CNT30582696Zea maysEchinochloa crusgalli38.7134.4895180forward
CNT30551854Zea maysOryza brachyantha38.7125.5387.78180forward

Expression of CNT305897

Peptides detected in this lncRNA

>peptide 1 (33 aa)
SDLTLFITLTMTKYSIILRRTSETNKAASNVLN*

Sequence

>CNT305897
TCCGACCTGACCCTGTTTATCACATTAACCATGACAAAATATAGCATCATCTTAAGAAGGACCTCTGAAACAAACAAAGCAGCCTCCAATGTCTTAAACT
GAGAAGACGATCGAGCCAGTTAATAATGCAAGAGGTTCATGATCGGATGTTGAGATGATTGAAACAGAATGAGCACAATTACACATGAAGATTTAATTTC
CCTGCAGTTTGGACATATCTAGGGTCGACAAGACAGGTGATGATCTCCTCCATTCCCATCAGACGCTGCTGCTAGCTGCTTCACCACTTCCAGAAAACGT
TGGAGCCGCACTTGAACTTCTCCTTCCCCTCGCACTCAATCTCGAGGTCCTGGCACCCAGTGAAGTTGTAGGGGAACTGGCAGCTGCCGAACTCCACGGT
GTAGGCGCGCGCAAAGTTGGCTCCACTGGTGGCCAGCCTCTTCTTGTCGTTCAGCTCCTGGTCGC