Detailed information on CNT30578609


BLAST search results

BLAST vs Swiss-Prot:
sp|P18566|RBS2_ORYSJ, E-value = 2e-76

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30604902Oryza barthiiOryza punctata7.661.2395.98199forward

Expression of CNT30578609

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MHNWSVNSVWFCGQAAQPRAQHVLAWRYSLINRIFASLLSQPNFSN*

>peptide 2 (32 aa)
MDENFLQLSLDFLLIRWFITCIQIYTNTYGIC*

>peptide 3 (50 aa)
MHLILPPLLTLPKPELVERRLTGRPAVDLSPWNGATEVAEEAITVGAIAT*

>peptide 4 (42 aa)
MINKYQHFAKPKFHCRRIQICSRYISCVYIAGALFSHILTQR*

>peptide 5 (36 aa)
MAIYAGNFWHLGRISLLTCTFRKSDLDALGKYHVPG*

>peptide 6 (95 aa)
MLDLSLVATRLLATWGLVGDEANQLHLPDVVEADDTDKGIGVGLLGLLELLEHLGGVGAAEHGQLPHGPIPAIVVPGRPVGLELLDALNWPHLNK*

>peptide 7 (33 aa)
MLELKPTTMLNVLLFLYYAGIDGIKSAFNSRQQ*

>peptide 8 (84 aa)
MRMIGNAPQLPSGVNQERPCQTLRSTAMIKIWPKLGLAQLAQVLACASFSICLIHFAGFWACIGVKIELKSPTLVWMKISFNLV*

>peptide 9 (70 aa)
MTVVEHANDRKCPATAIRSKSRASMPNPEINSDDQDLAETWLGPTGPSFGLCLLLNLPYPFRRFLGLHWC*

>peptide 10 (30 aa)
MSKILSLYLSTLDFMCYSLFLLPKINNYFS*

Sequence

>CNT30578609
CAAGGACGCCAAAAATGTTTGTTGGTATTTCTTAATGTTACTGTAAAATCCCCTAGTACACGGAAGATGCCGATGTAGCACTTCACCTAGGAGTATTCCA
AGGTATTGATTTCCTCATGGAACGTGTGTGTTCAGTTCCTCTTCAGGTTCACCAAGGATACAAAGCAAATGTGGGTAGAGGGTAGAGAAGATTAACTAAT
GAGAAACAGTGTCTAAGAAAAGTACAATTTTAATCCTAACATGGTACTTCAGGCACTGGTAACCCACTGTTCCCAGATGTCGCTCTACCACGTACACAAA
CAAGGAGGAATTAAGTGCTCTTGAGGGCTGTCACCACCTCTACACCCACCTCTAACGTATTATGGGATACGCAGCAACCACTAGAAATTAACTACCTAAA
CACCACGTTTAAGCAATTAATAACTATTGTAGTGTTTGTAACTCACTAAAGCAATCACTATATTTTAACGGATTATAGTGAACAGTGATCTCATACGCTA
ATTAGGAACTAGCCAATAATAGTTCTCACTAAACAAATCTTAATTACTCGAAATGATATTTCTATTAAAGCAAATAACAAAGTATAAGAAATAGAAAAGG
ATCACCGATAACTCTGGAATTCCTCCGATTTCTTCTACGACCTTAATCTTTCCCTAATTCTAGTATACAATAAAATACAATAAAGCCTCTTATAATTCAG
CTCAAGATTGGAGTGTGTGATGTGAAGTGAGGATGAGAGCTCCTTAAATAGGTAGGTATGACGGTTGTAGAGCATGCGAATGATCGGAAATGCCCCGCAA
CTGCCATCAGGAGTAAATCAAGAGCGTCCATGCCAAACCCTGAGATCAACAGCGATGATCAAGATTTGGCCGAAACTTGGCTTGGCCCAACTGGCCCAAG
TTTTGGCCTGTGCCTCCTTCTCAATCTGCCTTATCCATTTCGCAGGTTTTTGGGCTTGCATTGGTGTTAAAATAGAGTTAAAAAGCCCAACACTTGTATG
GATGAAAATTTCCTTCAACTTAGTCTAGATTTCCTCCTAATTCGGTGGTTTATTACCTGTATTCAAATATACACCAACACTTATGGAATATGTTAGAATT
AAAGCCTACCACTATGTTGAATGTTTTATTATTTCTGTATTATGCAGGTATTGACGGCATAAAATCGGCATTTAACAGCCGCCAACAATAACCATAACTC
GATCGTCAGATTGATACAACATCTGACAAATATAATCCCTAAAACAGGAGTATAGTATTACTTCTCATCGAGAAGGCCTGAACATGTCTAAAATTTTGTC
CCTTTACTTATCCACTTTAGATTTTATGTGCTACTCGCTTTTCTTATTGCCAAAAATCAACAATTATTTTAGCTAAGTCCGTATGCACAATTGGTCCGTC
AATTCCGTATGGTTCTGCGGTCAAGCGGCACAGCCGCGCGCACAGCACGTCCTGGCCTGGCGGTACAGCTTGATCAACCGAATCTTTGCTAGCCTCCTCT
CACAACCGAACTTCTCTAACTAAATCAACCTTCATATATACGAATCAAAAGTTGATATGGCTATATATGCTGGTAATTTCTGGCATTTGGGCCGTATCAG
TTTGTTGACGTGCACATTTCGTAAAAGTGATTTAGATGCTCTAGGCAAATATCACGTGCCAGGATGATAAACAAATACCAGCATTTTGCAAAACCAAAAT
TTCATTGTCGACGGATTCAGATATGCTCTAGATACATATCTTGTGTGTATATAGCCGGAGCTTTGTTTTCACATATCCTCACCCAACGATAATTGTAGTA
CTCTTACAATAATAACCGGTCGGAGAGGGAGGGAAGAGATTATTACATATGTGTTAAGAGCAGAGGCCATTGAGATGGTACATAACCAAACTGTAAAATA
AAAATATATAGCATATTATATATTGATATATCATCAACATAGCCCAAAACAAAGCTGCATACTATTATTATAGGCAGCAATCCACCAGCACGATGCTTGA
TCTTAGCTTAGTTGCCACCAGACTCCTCGCAACCTGGGGGCTTGTAGGCGATGAAGCTAATCAACTGCACCTGCCTGACGTTGTCGAAGCCGATGATACG
GACAAAGGCATCGGGGTAGGCCTTCTTGGCCTCCTCGAGCTCCTTGAGCACCTGGGTGGCGTCGGTGCAGCCGAACATGGGCAGCTTCCACATGGTCCAA
TACCTGCCATCGTAGTACCCGGGAGACCTGTGGGTCTCGAACTTCTTGATGCCCTCAATTGGCCACACCTGAATAAATAATGTAAAAATTTAAATCAGAT
TAATTTGAATTTCGTAACATGAGTTAATTTGATCCTTGACTTTAAAGGAGAAGCCTGAGGAGGTATATATCATATATACCTGCATGCACTTGATCCTTCC
GCCATTGCTGACGTTGCCGAAGCCCGAGTTGGTGGAGCGGCGGCTGACGGGGAGGCCGGCGGTGGACTTGAGCCCTTGGAATGGAGCCACGGAGGTGGCC
GAGGAGGCCATCACGGTGGGGGCCATAGCCACGTAGTTAGCTAGCTAGCTTACTGGCTAGTAGTAGTAGAGTATGTCCAGTAGCAGTGCTGTTGAGGCCC
TGTACGCTGGTTCACCAGC