Detailed information on CNT30578599


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002853, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697530Oryza barthiiOryza sativa27.5428.5199.16837forward
CNT30555565Oryza barthiiOryza glaberrima43.6362.9999.171326forward
CNT30371506Oryza barthiiOryza glumipatula43.7343.4298.421329forward
CNT30110392Oryza barthiiOryza longistaminata19.8748.0193.71604reverse complement
CNT30104613Oryza barthiiOryza rufipogon27.5430.5498.81837forward
CNT30117986Oryza barthiiOryza nivara37.8457.2499.221150forward

Expression of CNT30578599

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MKRTKKLSSNNNENTNYKKFSYKTDSQTLSRKSRVCLFLGQRE*

>peptide 2 (31 aa)
MNADMNKPMNCITEIKITLISLVLIYAYMLN*

>peptide 3 (33 aa)
MEPKVSKLETIKSGVIITAGSWFNTCTYGILTF*

>peptide 4 (34 aa)
MYWFVLDFTELLLSRMNYSLLPKKRQTLVSVSNV*

>peptide 5 (36 aa)
MWFSSSFKNPSLLFYCCSSGSKGDFARTKLLHLELG*

>peptide 6 (28 aa)
MWFLLCTCVPRFVTTNLCYNLTKTKLSHS

>peptide 7 (29 aa)
MHNICDAYCIRFLEYNYMHVCMQTYSGKL*

>peptide 8 (38 aa)
MQTQIHNLLISHAILQIKLLIIYDVFSIKSGLXFITFK*

>peptide 9 (61 aa)
SLSRSLLSLALWRTRAAPPIVGCVAAASVWLAGKVPPPPLLRPLPFLQSSLPLFPSLNLSI*

>peptide 10 (72 aa)
FSFSLSSLPGAVAHKGCAPNCRVCRRRLCLAGRQGAAAAASSSSPLPSILSSPVSLSKSLYIAHLPFSPLLP*

Sequence

>CNT30578599
TTTCTCTTTCTCGCTCTCTTCTCTCCCTGGCGCTGTGGCGCACAAGGGCTGCGCCCCCAATTGTAGGGTGTGTCGCCGCCGCCTCTGTCTGGCTGGCCGG
CAAGGTGCCGCCGCCGCCGCTTCTTCGTCCTCTCCCCTTCCTTCAATCCTCTCTTCCCCTGTTTCCCTCTCTAAATCTCTCTATATAGCTCATCTTCCCT
TTTCTCCTCTACTGCCCTAGTTAGTATTATCCTCAATCTCTTCAACTTCTGCTCTATGCTAGTGTTTATCTCTCCTTGGTGATGTCTGTGATAGCGGTGG
ACTAGTGATGCTGGTTGTATATAAATGATCCTAGTGGTCACTTGATTTTTTTTCTATACTCAGGGTTGTGCTTACTGATTTCAGGGTTCTTACGTTTGAC
TTGGTTTGGTGAATAATGTCTATATGCTCATGATAAATGAATGCTGACATGAATAAACCTATGAATTGCATTACTGAAATTAAAATCACACTAATATCAC
TGGTCCTTATATATGCATACATGTTGAATTAACTGAATCTTCTAAAATTGGTGACATACAAGCAGGATCAGATCTTTGACTAAAGTCTTATTAATTTACA
TGGTTCTACACTTTGATAATCATGGCAATTTCTATCTATACATATTGAATTATTGGACTGAAGATCCCTAAAACTTGAATCTTGAAGTTAATAAATGATA
ATTTGTTTCTCTAAATAATTTACTACTAGTCTATATGTCCAGAATTTCATCTCTATATAATTTATTAGATTAGAGTTATTGATAGATTATATTACTTACA
TTTGTTTTATTATGAGACTATGCTCTAAACATTTACTCTCCTGCACATAATAATCTGGTAAAGAAACTTGCATGTTCTGTTAAGTCTTTACGATTTAGTA
CAACTATTATTACTTTAACACTATACAGGCTTAAATGTACATCAAGATTCATCCTATGACGTCTTTTCTGAATTTTGTAGTAAAGAACTAGATACATATG
CAAACCCAGATTCATAACCTACTAATTTCACATGCTATCCTTCAAATCAAACTATTAATAATTTATGATGTTTTCTCTATTAAATCAGGGTTGANCTTCA
TTACTTTTAAATGAAATCAGATTCATAGACACAGATCCTAACCCTTCCAGGAATATGCACATGTCAAGGTTATGCCCTGTTTGCATGACTAGAATATGAA
AACNTACAANTTCNCATGCATGATCAGNTTCTTCTATACATGCTCTATTCCTAAATAATTTATATCATGAACACTAGTTGATTTATACAAGAATTACAGC
TACACATGCTTATTGATGCTATCAAGATTTCATATATTATAATTGATATACGTCTATATTAAGATTTAAAGACATACATTTATCTTAAACTATAGCCTCC
TAATTTTTGTCACTTATATTCATTTGGAATTTCTAAGGTTTTGGTCAGTATGGATGGTGCATATATCTGTATGAAACTCTAGCTCTAACAAATGCTGTTA
CTATGAATGCAGGATCTACTCTCCTTCCCTATTTTAATTTTTGGTTACCTCTGATGATTCTACAGTGATTGAAAAATATGTGGTTCAGCTCCTCCTTCAA
AAATCCAAGTCTTCTCTTCTACTGCTGCTCTTCTGGATCTAAAGGTGATTTTGCTAGAACTAAGCTTCTCCACCTTGAGCTTGGTTGATTGTTCCCCCTC
TTGAACTGAACCCCCTGTTCTACTTGGAACTCAGGTAATTCTCCTCCTTGGCCCTTCCTCTACTGGTAATACTTGACTGCTTCCTGACATCTTTCTTGAT
CTGCTACTGGTGATTCTCTTCCTCCTCTTGAGACTGATCCTCTTGCTTGATTATTGCTGCTCTATCTTGCTTCCTAACCTTGGTAACATCTTCTCCAAGA
GCTGAAACCCCTGTTCATCCAAGAACAGAACACCCTGCTTCTCCTTTTACTCCTCTGACCTCCCTCTCTCTCTCTCTTCCTGATTGTTTTTACTATGGAT
ACTATGCAGCTACGGTTAATTGATGTATTGGTTTGTGCTGGATTTCACTGAGCTGCTCCTCTCTCGAATGAACTACTCCCTCCTTCCCAAAAAAAGACAA
ACTCTGGTTTCCGTGTCCAACGTTTGACCGTCCATCTTATTTAAAAAAATTATGAAAAGAACTAAAAAATTATCATCTAACAACAATGAAAATACTAATT
ATAAAAAATTTTCATATAAGACGGACAGTCAAACGTTGTCACGGAAATCCAGGGTTTGTCTTTTTTTAGGACAGAGGGAGTAACTTTTTTTTGACAGAGG
GAGTAAGAGCTAAGCTACTTGCTACTACAGCTGTTGTTGCTCTTCTTAGCTGAGCCATACTACTCTACTACTGTTGCAACTGCTGATAATGCTGTTCCTC
GAGGTCGTCTCCCCAGCCAAAGCAACATGATGGCTAGTCTACTAGCTTGGCTAATATTTGTATGTAATTTGTGAGGGCATGGTGATGCAGCTGCCTGCAT
GTCGGTTTGGAAAAGGACTTGCTGCCACCTCATTTTTCACCTAATCAATTTGGGGTGAAAAAAGTAATTTCCTCTTTGATGTCATTTTGGTGATTACATG
GAACCTAAAGTCAGTAAATTAGAAACTATTAAGAGCGGCGTTATAATTACAGCAGGAAGTTGGTTTAACACGTGTACTTATGGAATTCTTACATTCTAGT
CCTTAAGGTTTTATAATATTTAAGATTTTACTAGAGCTCGAGGACTGATTTGTAATTGCTCTATGACTGAAGGTTTTTCTGAAAAATAAATAATTATTGA
ATCTTTGACTGAGATGTTTCAGTTTATGATATGGTATCTATAAGCACCTTGTAAATGCACAATATATGTGATGCATACTGTATAAGATTTCTAGAGTACA
ATTATATGCATGTATGTATGCAGACCTATAGTGGTAAATTGTAAATAAAGAGATGTGGTTTCTACTGTGCACATGTGTACCTCGCTTCGTGACGACTAAT
CTATGCTATAATTTAACCAAAACTAAATTATCCCACTCC