Detailed information on CNT30578593


BLAST search results

BLAST vs Swiss-Prot:
sp|P08626|ICI3_HORVU, E-value = 5e-11

BLAST vs NONCODE:
NONORUT002477, E-value = 9e-81

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30286679Oryza barthiiTriticum aestivum50.1514.3180.98163forward

Expression of CNT30578593

Peptides detected in this lncRNA

>peptide 1 (63 aa)
MREASRWWGCWRRCRRRCGRGWGGIHGHRRPHRNHDDVGVGHVLEDHLLRLLHRQPHHLQPRRL

>peptide 2 (38 aa)
MVTGVPTGTTTMSASGMSLRITFFASSTGSPTTSSHDVF

>peptide 3 (38 aa)
MVGVLATVPTKMRTRLGRNPWSPASPPEPRRCRRRACP*

Sequence

>CNT30578593
ACATAGGGTAAAACATTATTCAGATGGGGATGGATCGATTGAAACATACACAGTACATATCACTTGCGTGCATGTGATCATTATTTAATTAAGATAAAGA
TGGCCGGGGCCCGGTCGCTGAAGGAAGGCAGATGAGGGAGGCTAGCCGATGGTGGGGGTGCTGGCGACGGTGCCGACGAAGATGCGGACGCGGTTGGGGC
GGAATCCATGGTCACCGGCGTCCCCACCGGAACCACGACGATGTCGGCGTCGGGCATGTCCTTGAGGATCACCTTCTTCGCCTCCTCCACCGGCAGCCCC
ACCACCTCCAGCCACGACGTCTTCC