Detailed information on CNT30578591


BLAST search results

BLAST vs Swiss-Prot:
sp|P29766|RL8_SOLLC, E-value = 2e-64

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30546122Oryza barthiiIpomoea triloba11.5951.9984.15183forward
CNT30555589Oryza barthiiOryza glaberrima77.5870.298.21225forward
CNT30117466Oryza barthiiOryza nivara66.6294.18981052forward

Expression of CNT30578591

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MRPTFWPGGASRRTVEAFPALSIGFSVLPPPAT*

>peptide 2 (49 aa)
MHRQTISSTYATTILMVEQIESIHGQQYQVVHIQLYYNDRKNSRIIEQN*

>peptide 3 (30 aa)
MTTKTANIHHKCDQSTKQKARPYWNTCPLI*

Sequence

>CNT30578591
GGATTAAATAACCAGGTAAAAACTTCTTTAGGTGGAATGTAGAATCCAGACCATGACCACGAAAACTGCGAACATTCATCACAAATGTGACCAGAGTACC
AAGCAAAAAGCACGACCATACTGGAATACATGTCCTTTAATCTAGCGATGATAAGCATGGTAGCGAATATGGATAGTAGCAACAATAAGTAACACTCTAA
GTGGCCTTGTCGGCCTTGGCAGCGGTAGCGGCGGCCTGGCCTCTGAGACGACCAGTCCTCCTTGCAGCGATGAGACCAACCTTCTGGCCAGGAGGTGCAT
CACGGCGGACGGTGGAGGCGTTTCCAGCCTTGAGCATCGGCTTCTCAGTCCTGCCACCACCAGCAACCTGACCGATCATGGCACGGCAGCTGCTGGGGAC
AATCTTCTTGGCACCAGAGGGGAGCTTGATCCTGCAAGAAAATAATATCAACTAGTTGCATGAGCAATACAGTTTATTTGCACTGAACATTACAAAAAAA
TTGCAGGAATAAAAATACTTCACAAGGCCAAGGACATCTCTCCAACAGAAGCAAGCATGCGGATCAAACAAGGCGCATATGTAAAGGATTATCTTCTATG
TTAGCATACATACATCACTTGATAGCAAAATCATAAGCACAAACATAATTCACCACTTGAAAGAGCGAATTGGCCAATCATATTAATCATGCATAGACAA
ACAATATCTAGTACATATGCCACCACAATCTTGATGGTAGAACAAATAGAAAGCATCCATGGGCAACAATATCAAGTAGTACATATACAACTATATTATA
ACGATAGAAAAAACAGCAGGATTATTGAACAAAACTAGTTGTTTGTGGTGCTCTATTACACAGTATCAACAAAAGCAATTGTTCGAAAATACACTAAACT
AGCTACATCCAAGGCATTCGAATCATCTCTAAACAAATGGTACATATATTTACTTTGGGTCTCTACTAAATAACAAATAATTAAAGCAACATTAAATCGC
ATCATCCATATTTAGATTGAGCCGAGATCATTTCCAATAGATGAGTTCTTCTAATCACGCGAACAAATCAATTCAGATCCAATAATAGTAGTTACTACCA
CACAACTACGACACTAACAAACAGATCTAACACAAAACATCTCATCAATTCAGGCAAAAAAAAAGAAGCGAGAGAGATGGGGATCACCTGGATGTGCCGT
TGTCGGGGTTGTGGCTGATGACGATGGCGTAGTCGCCGGACGCCCTGGCGAAGACGCCGCGGTCGCCGACGTGGTGCTCGACGTTGCAGACCACGGCGCC
CTCGGGTACCGACCGGATCGGGAGCACGTTGCCGATGGAGAGCGTGGCGCGGCGGCCGCAGTAGACGAACTGCCCCGTGTACATCCCCTCCGCCGCGACG
AACAGCTCCTTCTGGTGCTTGTACCGGAACGGGTGGCGGAACCGGAACCTCGCGGGGCCCTTGCGGTGGTGGGTGTGGGACTTGAACACGGAGCCCGCAC
CCTTACGCTGCGCGCGGATCACGCGACCCATCTCCTCGTCGGCGGCGAGACGGCGGCGGCGGCGGCGGGGAGAATGGGG