Detailed information on CNT30578586


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555777Oryza barthiiOryza glaberrima22.7662.45100519forward
CNT30111414Oryza barthiiOryza longistaminata8.863797.52202forward

Expression of CNT30578586

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MGAEQPSASPCMNSFGSNSESIFKLQRRRKHHYLITSLLHFCSDLL*

>peptide 2 (42 aa)
MLAGKIKESATLRGLDIDAWHLHYPASTGLSQDQSNYLLVFV*

>peptide 3 (35 aa)
MSHLIFSLSDASMIFVSCISANPMLIFVWSCFVAL*

>peptide 4 (37 aa)
MAVSSEVAIREGRYGMQGAARSWASGGSLAGANAPGA*

>peptide 5 (44 aa)
MNLCLLGRVVPITLMTSFILHHFHQLHNQHNMCAAEHCKYWYVQ*

>peptide 6 (54 aa)
MDKCWRGRLRNLQHCVGSTLMRGTCTIRRPRVFLKIRVTIYLYLYKKNMDNKDV*

>peptide 7 (51 aa)
MHCVCVCFRCNVDSHRFNSMFENHQCNSDLVSNKRNFMATSICYVESIGVIV

>peptide 8 (51 aa)
MICIVFAYVSDAMLTAIDLIVCLRTISVIVTWFLIREILWQHQYVMLSPLV*

>peptide 9 (32 aa)
MTLWSVSIGMIFVILSDVVHNTHSQQLSSPCD*

>peptide 10 (85 aa)
VCRDWQLITHLQIYPRWRVHLRYRPETSPRLLRAPGINSTTHRICSLFLLSSFFFFLFTHLLFSQGSKPWIIVVRPAAAAAILLF*

Sequence

>CNT30578586
TGTTTGTCGTGATTGGCAGCTAATTACTCACCTTCAGATCTATCCCCGGTGGCGCGTGCACCTGCGTTATCGGCCAGAGACCTCACCACGTCTCCTCCGT
GCACCCGGCATCAACTCCACCACCCATCGGATCTGCTCCCTTTTCCTGTTGTCTTCATTTTTTTTCTTTCTTTTTACACACCTGTTGTTTTCACAGGGAT
CAAAACCATGGATAATTGTGGTTAGGCCTGCTGCTGCTGCTGCTATACTGTTGTTTTGATGATGAATTCAGTGCATCCTTCCTTCCTTCGATCTTGATTT
TGGTTCATGTTCATCTTTTCTTGATTTTGGTTGCGGCAGCGATGGCAGTAAGCAGCGAAGTCGCGATACGCGAGGGGCGCTACGGCATGCAGGGAGCGGC
AAGGAGCTGGGCTTCTGGGGGAAGCCTGGCAGGGGCAAACGCGCCGGGCGCCTAGGTGGTCAGATGGGAGCAGAGCAACCTAGCGCTTCTCCCTGTATGA
ATTCTTTTGGTTCCAACAGTGAGTCAATCTTCAAATTGCAACGGAGAAGAAAACACCATTACTTAATTACTTCATTGCTCCATTTTTGTTCAGACTTACT
GTGAGAAATTACCCTGGAGTTTGGGAACATGCCTAAACTTAGCTACCTGTAAGTGATATTTGTCTTATGTAGATGATGTTTTTGTAACTCCAGTTGATGT
GGAGCACTATAGGAGGTTAAGGTTTGGAATTTTTTTTTCCATGCATGGCAACTTAATGACAATGATTAGTGGGGTTAAAGATATGTGGTTGATAAATACT
GAAGAATTTTGATGACCTTGTGGTCTGTGTCCATCGGTATGATTTTCGTTATTTTAAGTGACGTTGTGCACAATACTCACAGCCAACAACTCAGTTCTCC
TTGTGATTAGGAATAGTAAGCAAGAGAATACCTCCACTGTAGTCTATAATTGCACTAGCTAGTCAGTTCCCTGGAAATGTTAAATAATATGGTTGCTAAA
ATGAATTTAACAACCATGGACAACCTACTGAAATGAAAAATGGCAGTATCGTTTTAGCAGCAACCATTGCAAGCATAAACACACTATATATACTATGTCA
TGTATGATGGATTGATGGGTCCGTGAACACAACAGGAATAATCACAATTAGAAGTAATTTTACTCTGAAATTGGTCACTGCTCACTACATACGGTCCTAT
CTAATACAACTGATCGATTGATTTCCTCTGAATCGCTCACTATATAAGGTCCTATCGAACAGGAATAATCACAACCGGGCATGGTTGATGGATAAATGTT
GGCGGGGAAGATTAAGGAATCTGCAACACTGCGTGGGCTCGACATTGATGCGTGGCACTTGCACTATCCGGCGTCCACGGGTCTTTCTCAAGATCAGAGT
AACTATTTACTTGTATTTGTATAAAAAAAATATGGATAACAAAGATGTGTAAGTAAATCTGAAATCATTTTTTAGTAAAAAAAAATTCTGAAATCGTTTT
GCTATGGTCAACTGAACAAACTCTGAAATTGATTTTGCTTGATGAACTAAACTCTGAGAAATGAATCTATGTTTGTTAGGCAGAGTTGTTCCCATCACAC
TAATGACTAGCTTTATATTACATCATTTCCATCAATTGCACAACCAACACAATATGTGTGCAGCAGAACATTGCAAATATTGGTATGTACAATAAATTAA
GTGGTGAGGATTAATTACTTTGGTGATGGCATGTCAATATGATTATGTGTGTTTGATTCTCAATTTACTATAGATATTTTTGACAATGTAACAATGTCAC
ATTTAATTTTTAGCTTGAGTGATGCTTCAATGATTTTTGTTTCCTGTATTAGTGCAAACCCCATGCTAATATTTGTGTGGAGTTGTTTTGTTGCCCTTTA
GGTGGTACATGCAGAAGAGCCCTAGGTACTGGCAGAGGAAAGGCATCCATCGCATCTCTCGTCTCTGCTGCTCAAAAGGCTAAAACTATATGATTTTGTG
CCTCTAGTAAACATTGGGAAGTTGGAAAGTGGTCTTCTTGAGCGGATTCATTGACAAGCTACTATGTTTATTGCCTGTAATGTTTATTCTGGAGATGCAC
ATGCCTAAAATGTTTTCATGATATGCATTGTGTTTGCGTATGTTTCAGATGCAATGTTGACAGCCATCGATTTAATAGTATGTTTGAGAACCATCAGTGT
AATAGTGACTTGGTTTCTAATAAGAGAAATTTTATGGCAACATCAATATGTTATGTTGAGTCCATTGGTGTAATAGTAAT