Detailed information on CNT30578561


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30604822Oryza barthiiOryza punctata10237.6490.69204forward

Expression of CNT30578561

Peptides detected in this lncRNA

>peptide 1 (48 aa)
PRSAVVPAGDGWIPPAAAPGAVRSLPLSLPFAWCSSGDRIAGGGKAHS*

>peptide 2 (65 aa)
SIRGCSRRRWMDPAGGGARSRPVSASLPPFRVVFERRSHRRRRQSSLLTFQANLMSSRAYSTANVV

>peptide 3 (65 aa)
LDPRLFPPEMDGSRRRRRPEPSGLCLSPSLSRGVRAAIASPAAAKLTLNIPSKFNVVESIFNSKRG

Sequence

>CNT30578561
CCTCGATCCGCGGTTGTTCCCGCCGGAGATGGATGGATCCCGCCGGCGGCGGCGCCCGGAGCCGTCCGGTCTCTGCCTCTCTCCCTCCCTTTCGCGTGGT
GTTCGAGCGGCGATCGCATCGCCGGCGGCGGCAAAGCTCACTCTTAACATTCCAAGCAAATTTAATGTCGTCGAGAGCATATTCAACAGCAAACGTGGTG