Detailed information on CNT30578553


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30225212Oryza barthiiHordeum vulgare14.1620.288.7580forward
CNT30397702Oryza barthiiTriticum turgidum21.0631.0784.03119forward
CNT30555755Oryza barthiiOryza glaberrima77.1737.81100436forward

Expression of CNT30578553

Peptides detected in this lncRNA

>peptide 1 (46 aa)
LKQLRLTYLHILTGRTYSRIYIQPMDGSIGNIFNYVLLRSSSCLEQ*

Sequence

>CNT30578553
TCTCAAGCAATTAAGGTTGACTTATTTACATATTTTGACCGGCCGAACATATAGTCGCATATACATTCAACCGATGGATGGATCGATCGGAAACATCTTT
AATTATGTTCTGCTTCGATCGTCGTCTTGTCTTGAGCAATAATCAAGCTGCCACATCTCAATAATCTGTAGCGAGCGACAAGTATAGTATATAATCACCC
CCGAAGAAAAAGTAGTACTCCTCCGTAGTATTATATAATTAGTGGGCATGATCTGTAGGTAAAAAATCAGGCTCGGGTGCGGTTATTGTTGATTAGCAGC
GCGGAGCAAGGAGAGGTAGTAGGGCACGTTGCGGGCGCCGGCGACGTGGCCCTTGTCGAAGTCCTCCCACATCCTCACGTCCAGGTATTGGTGCCTCCCC
GAGCTCAGCAGCGCGCACGCCTCCTCCGCGTCCACGCTCCTCATCACCCTCTCCGTCTCCTCCTGCTTACTGCAATCTCCTCCTCCTCCGCCGTCGCCGC
CGCCTCCTCTCAGCGAGCCCATATCGATCGATCGATCGGTCGACCGGCGCTTAGCTGGGTGTGGC