Detailed information on CNT30578521


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697589Oryza barthiiOryza sativa58.5410098.87617forward

Expression of CNT30578521

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MSNNKTSVVSSSAAGSMSRSLLQSSTTTDDEQVTEMLLHWLLSPACAAACSSLLLLPGLWQWLSVLICDASTTT*

>peptide 2 (37 aa)
LLHSTSYVDAKNCSGFLVVVERSYMETTNCPSLLVPE*

>peptide 3 (53 aa)
MIAIVAVGMVQVFSLLHRLCSLALLFLPVGASVVAPAQFRLMQIYILVGVYTD*

>peptide 4 (36 aa)
AASFHIICGCKKLLWFSGGCREKLYGDHKLSLVTGP*

>peptide 5 (37 aa)
MYSSTVPFFVSCSVLSSRSATNIHSQGVLPLRSVRLR*

Sequence

>CNT30578521
GCTGCTTCATTCCACATCATATGTGGATGCAAAAAATTGCTCTGGTTTTCTGGTGGTTGTAGAGAGAAGTTATATGGAGACCACAAATTGTCCCTCGTTA
CTGGTCCCTGAATAGGGACATGCTTGCTTTGACTCCAATGGAACGCAATCAATTGTTCCAACCGGCTGGCCAGCAGTGACCGGGATGTTTTACTCCATCA
AAAACACGGCGTGACCGTGCGAGTCAAGAAGGAACACGCCAATACCTTATGTTCAGTTTGACAGCACGCTCGGATGGATGTACTCCAGTACCGTGCCATT
TTTTGTTTCCTGTAGTGTTCTGAGCAGCCGGTCGGCGACAAACATACACAGTCAAGGTGTTCTGCCGCTTCGTTCTGTCCGCCTAAGGTAAAAACATAAT
GGAGCTGATTTTGAAAAGAGAACTACTGCCGGGCGAGGATGGTCTGGATGGATGGATCAACTTTGAAAAGAAATAAGATGTGTGTTAAACATCTCATTCT
TTTGCTGATGCGCTGAAACGAGTCATGTCGAACAACAAGACATCAGTGGTCAGTTCATCAGCAGCTGGCAGCATGTCAAGAAGCTTATTGCAATCCTCAA
CGACGACTGATGATGAACAGGTGACGGAGATGTTGCTGCACTGGCTGCTGTCACCGGCGTGTGCCGCAGCCTGCAGCTCGCTGCTGCTGCTGCCCGGACT
CTGGCAATGGCTGTCGGTGCTAATCTGTGATGCTTCGACGACGACATGATCATCAGCTGATGCCGCAGGGCCCTTGCAGCAGGTGTGCTGGCCGTAGTAG
ACCACCGTGTACATGACGGGATGATCGCCATTGTAGCTGTTGGCATGGTGCAGGTCTTCTCGCTGCTGCACCGTCTTTGTAGCCTTGCACTTCTCTTCCT
GCCTGTAGGTGCATCTGTAGTAGCTCCTGCTCAATTCAGATTGATGCAGATATATATATTAGTTGGTGTTTATACTGATTAGATCTTGATAACACGATTA
ATCAAGGGTGTAATTAATTGAATGAAACTATTGATTCATGAATGTCTGATTACA