Detailed information on CNT30578486


BLAST search results

BLAST vs Swiss-Prot:
sp|P18566|RBS2_ORYSJ, E-value = 4e-121

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30597224Oryza barthiiOryza meridionalis67.5894.0898.5667forward
CNT30371494Oryza barthiiOryza glumipatula49.8571.8299.19492forward
CNT30117977Oryza barthiiOryza nivara82.0785.3598.89810forward

Expression of CNT30578486

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MKLINCTCLTLSKPMMRTKASGYAFFASSSSLSTWVASVHPNMGSFHMVQYLPS*

>peptide 2 (81 aa)
DGFRYALGIILHEYVCIAGDLAFTCPVSPSPNDRPIVVVVLLQQRQVGARENNYVQLNTDTQKKKEKERTCTKERKRLVAA*

>peptide 3 (50 aa)
MHLILPPLLTLPKPELVERRLTGRPAVDLSPWNGATEVAEEAITVGAIAT*

Sequence

>CNT30578486
GACGGATTCAGATATGCTCTAGGCATCATATTACATGAGTACGTGTGTATAGCCGGAGATCTTGCATTCACGTGCCCTGTCTCACCGTCACCGAACGATA
GACCGATAGTTGTAGTAGTACTCTTGCAACAACGGCAGGTCGGAGCGCGAGAGAACAATTACGTGCAGCTTAACACGGACACACAAAAAAAAAAAGAAAA
AGAAAGAACATGCACGAAGGAACGAAAGCGCTTAGTTGCCGCCTGACTCCTCGCAACCCGGTGGCTTATACGCGATGAAGCTGATTAACTGCACCTGCCT
AACGTTGTCAAAGCCAATGATGCGAACGAAGGCATCAGGGTATGCCTTCTTTGCCTCCTCGAGCTCCTTGAGCACTTGGGTGGCATCGGTGCATCCAAAC
ATGGGCAGTTTCCACATGGTCCAGTACCTACCGTCATAGTATCCGGGTGATCTGTGATTCTCACGGTAGACGAATCCGACCTTGCTGAACTCCAAGCAAG
GCACCCACTTAGATCGGAGCAGGTACTCGATCTGCTTCAAGAGATCCTCCACGGTGAGTGGTGGCAGGTACGATAGGGTCTCGAACTTCTTGATGCCCTC
AATTGGCCACACCTGAATAAATAATGTAAAAATTTAAATCAGATTAATTTGAATTTCGTAACATGAGTTAATTTGATCCTTGACTTTAAAGGAGAAGCCT
GAGGAGGTATATATCATATATACCTGCATGCACTTGATCCTTCCGCCATTGCTGACGTTGCCGAAGCCCGAGTTGGTGGAGCGGCGGCTGACGGGGAGGC
CGGCGGTGGACTTGAGCCCTTGGAATGGAGCCACGGAGGTGGCCGAGGAGGCCATCACGGTGGGGGCCATAGCCACGTAGTTAGCTAGCTAGCTTACTGG
CTAGTAGTAGTAGAGTATGTCCAGTAGCAGTGCTGTTGAGGCCCTGTACGCTGGTTCACCAGCAGCTTATATAAACAGCAATCGTAT