Detailed information on CNT30578479


BLAST search results

BLAST vs Swiss-Prot:
sp|P18566|RBS2_ORYSJ, E-value = 1e-121

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555750Oryza barthiiOryza glaberrima94.2757.199.65856forward
CNT30664619Oryza barthiiTriticum dicoccoides41.342.9683.73375forward
CNT30684972Oryza barthiiTriticum urartu41.356.6583.73375forward
CNT30604900Oryza barthiiOryza punctata26.8737.4896.31244forward

Expression of CNT30578479

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MHLILPPLLTLPKPELVERRLTGRPAVDLSPWNGATEVAEEAITVGAIAT*

>peptide 2 (54 aa)
MKLINCTCLTLSKPMMRTNASGYAFLASSSSLSTWVASVHPNMGSFHMVQYLPS*

>peptide 3 (50 aa)
TADVDTNKMKKKTEATNWERGNQCKVARFERSKLPKPNRSIESPLYRAHE*

Sequence

>CNT30578479
CACAGCTGATGTTGACACAAACAAGATGAAAAAAAAAACTGAAGCAACAAACTGGGAAAGGGGAAACCAATGCAAGGTGGCCCGATTCGAACGTTCAAAG
CTGCCAAAACCGAATAGATCAATCGAGTCTCCTCTGTATAGAGCTCACGAGTGAGCTTGCTGGCTTGCCAACTAGCTTAGTTTCCGCCGGACTCCTCGCA
ACCCGGGGGCTTGTAGGCGATGAAGCTAATCAACTGCACCTGCCTAACGTTGTCGAAGCCGATGATGCGAACAAATGCATCTGGATATGCCTTCTTGGCC
TCCTCGAGCTCCTTGAGCACCTGGGTGGCATCAGTGCATCCGAACATGGGCAGCTTCCACATGGTCCAGTACCTGCCATCATAGTACCCAGGAGACCTGT
GGTTCTCACGGTAGACGAACCCGACCTTACTAAACTCGAGGCAAGGCACCCATTTGGACCGGAGCAGGTACTCGATCTGCTTCAAAAGATCCTCCACGGT
GAGTGGTGGCAGGTACGATAGGGTCTCGAACTTCTTGATGCCCTCAATTGGCCACACCTGAATAAATAATGTAAAAATTTAAATCAGATTAATTTGAATT
TCGTAACATGAGTTAATTTGATCCTTGACTTTAAAGGAGAAGCCTGAGGAGGTATATATCATATATACCTGCATGCACTTGATCCTTCCGCCATTGCTGA
CGTTGCCGAAGCCCGAGTTGGTGGAGCGGCGGCTGACGGGGAGGCCGGCGGTGGACTTGAGCCCTTGGAATGGAGCCACGGAGGTGGCCGAGGAGGCCAT
CACGGTGGGGGCCATAGCCACGTAGTTAGCTAGCTAGCTTACTGGCTAGTAGTAGTAGAGTATGTCCAGTAGCAGTGCTGTTGAGGCCCTGTACGCTGGT
TCACCAGC