Detailed information on CNT30578457


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QLY5|METE1_ORYSJ, E-value = 4e-63

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672574Oryza barthiiSetaria viridis25.0424.7492.96142forward
CNT30533996Oryza barthiiEucalyptus grandis12.1728.2886.9669forward
CNT30491477Oryza barthiiOlea europaea13.424.3685.5376forward
CNT30711924Oryza barthiiGlycine max30.6931.6981.61174forward
CNT30555782Oryza barthiiOryza glaberrima46.0365.5898.85261forward
CNT30282Oryza barthiiZea mays26.4649.3490150forward
CNT30212158Oryza barthiiHelianthus annuus17.8125.9682.18101forward
CNT30129112Oryza barthiiCorymbia citriodora15.3423.3983.9187forward
CNT30367300Oryza barthiiSorghum bicolor19.7524.8384.82112forward
CNT30105511Oryza barthiiOryza longistaminata44.0910098250forward
CNT30604899Oryza barthiiOryza punctata39.3395.7198.21223forward
CNT30333329Oryza barthiiCynara cardunculus19.422.7382.73110forward

Expression of CNT30578457

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MSAKYVSISTFNPESADSSSVYAAENAANW*

>peptide 2 (56 aa)
FPTIASRDSRVVRDAARSSAQMLRPSTTPAKRYLPEGKPAFLTRSRVLAPRIRSKP*

>peptide 3 (95 aa)
LSNNSLKRLEGGERCGEIISPDVAPIHNTSKEVLARGETSILDKVKSLGSTDKVKTISSHAVQGCEGPAVKRQYQCSATKKKKHAKGKAGLVMIR*

Sequence

>CNT30578457
CCTTTCCAACAATAGCCTCAAGAGACTCGAGGGTGGTGAGAGATGCGGCGAGATCATCAGCCCAGATGTTGCGCCCATCCACAACACCAGCAAAGAGGTA
CTTGCCAGAGGGGAAACCAGCATTCTTGACAAGGTCAAGAGTCTTGGCTCCACGGATAAGGTCAAAACCATAAGCAGTCACGCTGTTCAGGGATGTGAGG
GTCCTGCAGTGAAAAGGCAGTATCAGTGTTCTGCCACTAAAAAGAAAAAGCATGCTAAAGGAAAGGCGGGTTTGGTAATGATACGATAGTACAGGAAATA
AACATACTTGTATGATTCAGCAGGAATGTCAGCGAAGTATGTCTCAATAAGCACATTCAATCCAGAAAGTGCCGACTCAAGTTCTGTGTATGCAGCAGAG
AATGCAGCCAATTGGTGAGAGTCAAGGTCAAGAACAAGTGTGGGTTCATCAAACTGAATCCATGTAGCACCAGCTGCCTTCAACTCAGCAATAACCTCCC
TACAAATCATCATGCATCAAATTATGAACTGAAGATTTAGCGCTAGCAGCAGTTATAGACTTGTTTG