Detailed information on CNT30578426


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0IQK9|NLTP1_ORYSJ, E-value = 5e-30

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30524204Oryza barthiiSetaria italica40.9532.8188.44147forward
CNT30352811Oryza barthiiEragrostis tef27.8613.490100forward
CNT30371391Oryza barthiiOryza glumipatula82.7371.91100297forward
CNT30151138Oryza barthiiBrachypodium distachyon32.0338.8589.57115forward
CNT30118027Oryza barthiiOryza nivara33.1532.16100119forward

Expression of CNT30578426

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MLAALPALSPLMPRAAFLRQLQAVRRSAVVLAAALRLLTPLQQSCHQGDQHQLCTGHAS*

>peptide 2 (99 aa)
PGAVDGSADGVGDADAALGGDAGGVAGVEPLDAAGRVLEAVAGGAPVCGRACCRLEAPHAAAAELPPGRPTPTVHGPCFLASTVDLVAGSIDRSVRIGC*

Sequence

>CNT30578426
CCTGGAGCAGTCGATGGAAGCGCTGATGGTGTAGGGGACGCTGACGCCGCACTTGGAGGGGATGCTGGCGGCGTTGCCGGCGTTGAGCCCCTTGATGCCG
CGGGCCGCGTTCTTGAGGCAGTTGCAGGCGGTGCGCCGGTCTGCGGTCGTGCTTGCTGCCGCCTTGAGGCTCCTCACGCCGCTGCAGCAGAGCTGCCACC
AGGGCGACCAACACCAACTGTGCACGGGCCATGCTTCCTAGCTAGTACTGTTGATCTAGTTGCTGGATCGATCGATCGATCGGTGCGAATTGGTTGCTGA
TGATGAGATGGATGATGGATGGATGAGGAGAATACGCGGGAATGCAGGGGCTTAAATAG