Detailed information on CNT30578423


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697920Oryza barthiiOryza sativa101.51100.2690.181140forward
CNT30590960Oryza barthiiMusa acuminata14.657.7582.32164forward
CNT30555734Oryza barthiiOryza glaberrima30.8138.92100346forward
CNT30371395Oryza barthiiOryza glumipatula45.5991.9298.83512forward
CNT30104541Oryza barthiiOryza rufipogon70.0873.0190.85787forward
CNT30118048Oryza barthiiOryza nivara101.0754.0596.831135forward

Expression of CNT30578423

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MSSQESRPTRLLNSAKTVVRGDLMRWNPISMSSCLVCSGVFPPSSMLHTR*

>peptide 2 (30 aa)
MNLFKIYSLVVKIDRSNLNESLTLKRFSRT*

>peptide 3 (35 aa)
CNNNTYLTKFTNNAGELINVIHHISWLPDGQPHFD*

Sequence

>CNT30578423
TGCAATAATAACACATACCTCACAAAATTCACCAATAATGCAGGAGAATTAATCAATGTAATCCACCATATTTCATGGCTCCCTGATGGCCAGCCACATT
TCGATTGATAATTTATTCCATTGGTAGCTTGATCTTGATCGATCTTAGTGTACCCCATTGGTAGCGCCATTGGTAGCTCCGTTTCCGGCAACGACGGCGG
CCGCCTTGGCCTTAGCCTTCTCCATCTCCGTCGTGGTCGTCGTCTCCGGCGCCGGCAGTGGCTTGGGAACGGAGGAGTTGACGGAGAAGCGGGCCTCGAT
GTCGAGCCAGGAGTCGAGGCCGACGAGGTTGTTGAACTCGGCGAAGACGGTGGTGAGGGGGGACTTGATGAGGTGGAACCCCATCTCCATGAGCTCCTGC
CTCGTGTGCAGCGGCGTCTTCCCGCCCTCCAGCATGTTGCACACGCGATAACCCTTGGTCCTCCTGCAGATCTCCATCAGCTCCTCGTCGCTCCGCGGCG
CCTCCACGAAGCACGCGTCTGCTCCCGCCTACAATTTTTTTTTGTTTTTTTTACATATATTCATATTAGATATGATATGATGTTGCATAATAACTTAATT
ATATTTATGGTGATCTCTACTGGTATGAATATATCCTACTAGTAATAAGTAGGAAAAGAAATTATTCTATTATCCTTAGTTGAGGTAGTAATATAATAGA
TATGATTTATTTGATTAGAAGAAAATGAACGGTTTATTAGATTGAATTCTACAACCGGTAAAGACCAATGTAAAAACACCAATGGGTTAAATTCCATTAT
AAAGGAGAAAAAAATATACTATACGGATATTGTTTGTGGGCCTAGTAATAGAAGACAAACAAAGATGCAAACCATTTTCATTTCATTATGTAAAGAAAGT
GTTTTCGCCTTAAATATATCAGTTTTCAAAATGCAGCTTTGACAAATATCTAATGAAAAAACTAATTAATTTCAAAACATTGATTCTTGACAGACTTGAT
GAACTTGTTTAAGATTTATAGTTTGGTGGTAAAGATCGATCGATCAAATTTAAACGAGAGTTTGACTCTGAAGAGATTCTCTAGAACATGATTTATCTCT
CTCTAGAAAAAAGAAGTGGTCGA