Detailed information on CNT30578422


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QLY5|METE1_ORYSJ, E-value = 1e-37

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555741Oryza barthiiOryza glaberrima10093.67100207forward
CNT30597221Oryza barthiiOryza meridionalis94.291.1297.44195forward
CNT3027096Oryza barthiiPopulus trichocarpa50.2429.8982.69104forward
CNT30104583Oryza barthiiOryza rufipogon10097.6499.52207forward

Expression of CNT30578422

Peptides detected in this lncRNA

>peptide 1 (67 aa)
LTLSNNSLKRLEGGERCGEIISPDVAPIHNTSKEVLSRGETSTLDKVKSLGSTDKVKTISSHAVQGCE

>peptide 2 (58 aa)
LPFPTIASRDSRVVRDAARSSAQMLRPSTTPAKRYFPEGKPALLIRSRVLAPRIRSKP*

Sequence

>CNT30578422
GCTTACCCTTTCCAACAATAGCCTCAAGAGACTCGAGGGTGGTGAGAGATGCGGCGAGATCATCAGCCCAGATGTTGCGCCCATCCACAACACCAGCAAA
GAGGTACTTTCCAGAGGGGAAACCAGCACTCTTGATAAGGTCAAGAGTCTTGGCTCCACGGATAAGGTCAAAACCATAAGCAGTCACGCTGTTCAGGGAT
GTGAGGG