Detailed information on CNT30578394


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30473070Oryza barthiiSaccharum spontaneum8.114083.3390forward
CNT30117799Oryza barthiiOryza nivara66.3145.6699.86736forward

Expression of CNT30578394

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MAPAAAMQSEDDDDWLLSFDRARFIIQGLPFL*

Sequence

>CNT30578394
GCAAGCGCGCTACGTCTACGCGCGGTTAGTCCCGCCGTATCTCCTCCTTGAAGGTGAGCTCCGACGCCAAGGCAGCTAGCTGCTTTGCTGCTGGCTCCTG
GGTCCAGGCTGCTGAAGCTGAACAGAACACCGTCATGGCCCCGGCAGCGGCGATGCAATCCGAAGATGATGATGACTGGCTTTTGAGTTTTGACAGAGCC
AGATTCATCATTCAAGGACTTCCATTTCTGTGAGCAGACAAGCATGCCACATACTTAAGCTATGCCTCATTACTCAGCCCATTAGCAAGTGTTAAGTATT
ATTACTGTTTCAAATTTATTATTGATAAGAAACAATTCCTCTGCACTTGGCTAACTACACTCATCTGATGCCGCAGGTAACACCATAAAAGGCTCAAAAG
TAAATATGAGTCCAATGAGCTCCACAAAGTTCAGCATCAAGAACACCACTTGATCACCTACAGATACTTAAAATTTGAAGGAAGAGCTTTGAAATTGCTT
ACTGCAAGAGCACTTTTCATCATTGCCGCTGAATAAAGAGCTAAGGAAAGTTCCGCGCCAGATAGGTTTCCTTCCTATACGATCTGCCACAACTCCCCAA
AATATCGCGGCAAAGGATCTACCAACCATGTCCCTTACCTATGAAAACAGAGATGATTGAATAAGCCAGAGTATTCAATATGCGAAAAGGGGATCACTGA
GATGCAACTTGAATGAACCAGTAGAGATCTTGATAAAGAGAACTACGGGGCAGGCACTCCCGTTATATATGCTACATAGATCTGAAGATGATGGTTTGAC
GTACAAACTGAAATCGTGTCAGAAATTCAAGGAAGGCTATGAGTTTTTCTTTTAGACAAAGGACCAATGAGTCCAGCTATACAAAGCAAAACGGTGAAGG
CTACAGTTGGAATATCTCATGAGATCCAAGTTGCAACCAAGTGGTAAGGTATAATGGTTAGGGAGAAATGTGTGAACTGGGCCATGCATTCGAAATGATC
CAGGGTTCAGAGATTAATTAGGAATGATGCAAAGCAGTGTCCTTCAAGTTGGGTAAACGTCTTTGTGCGACGCAGGTGATACTGTAGCTCAAGACGCATG
ATGAAATAAT