Detailed information on CNT30578384


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673197Oryza barthiiSetaria viridis35.4626.3897.12139forward
CNT30520774Oryza barthiiSetaria italica35.4612.3697.12139forward
CNT30533721Oryza barthiiEucalyptus grandis24.2313.6187.3795forward
CNT30516978Oryza barthiiJuglans regia28.0616.1386.36110forward
CNT30698134Oryza barthiiQuercus lobata28.836.0684.96113forward
CNT3021623Oryza barthiiCitrullus lanatus20.415.898580forward
CNT30730016Oryza barthiiCorchorus capsularis20.4112.0883.7580forward
CNT30629841Oryza barthiiVigna unguiculata23.2115.5686.8191forward
CNT30710020Oryza barthiiGlycine max29.5925.2785.34116forward
CNT3042792Oryza barthiiPrunus dulcis28.8330.6284.96113forward
CNT30182270Oryza barthiiSecale cereale33.9324.0989.47133forward
CNT30294278Oryza barthiiTriticum aestivum33.9330.8694.74133forward
CNT30222663Oryza barthiiHordeum vulgare33.1625.6989.23130forward
CNT30390478Oryza barthiiTriticum turgidum33.9311.1688.72133forward
CNT30560479Oryza barthiiActinidia chinensis26.539.8884.62104forward
CNT3084834Oryza barthiiVigna radiata27.327.7985.98107forward
CNT30249726Oryza barthiiAvena sativa33.1616.2191.54130forward
CNT30454500Oryza barthiiSaccharum spontaneum35.4638.492.09139forward
CNT30135064Oryza barthiiLolium perenne33.1622.7792.31130forward
CNT3014188Oryza barthiiZea mays35.4618.1994.96139forward
CNT30720963Oryza barthiiTriticum spelta33.9323.8888.72133forward
CNT30344813Oryza barthiiEragrostis tef35.4626.5894.24139forward
CNT30620323Oryza barthiiCajanus cajan28.836.3284.07113forward
CNT30483616Oryza barthiiChara braunii32.431.7581.89127forward
CNT30570425Oryza barthiiVitis vinifera20.414.687.580forward
CNT3037519Oryza barthiiCucumis melo22.78.6184.2789forward
CNT30104607Oryza barthiiOryza rufipogon58.9364.35100231forward
CNT30582394Oryza barthiiEchinochloa crusgalli35.4637.2794.96139forward
CNT30604850Oryza barthiiOryza punctata20.668.3410081forward
CNT30557050Oryza barthiiPanicum hallii35.4636.5897.12139forward
CNT30551896Oryza barthiiOryza brachyantha36.4821.5795.8143forward
CNT30112090Oryza barthiiFicus carica31.636.0689.52124forward
CNT3040359Oryza barthiiMarchantia polymorpha28.0614.6983.64110forward

Expression of CNT30578384

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MPPKKKPPVNLAQPSAVCSLSASFLRPVSVSVG

>peptide 2 (78 aa)
MHFIYTSRRHSNQPPHEHTHVPSSIDLHMHHPVEHVEEEVGPEDAGDAAEEEAAGELGPAVGGLQLVGLLLAAGERQRR

Sequence

>CNT30578384
AACTAATATAATTACAACAAACTGATTAATTATCATTGTTAAAACTTTTTCTTTCCATGTAAATTATCTGCAAAGTAAGAAAGTAACACTCCCAAGTTAC
AACAGCACACCATCCATATATCCATGCAGGCAGCCTGTTTGTGCCCTTGTGCAGATGCATTTCATTTATACAAGTAGAAGGCACTCAAATCAGCCACCAC
ATGAACACACACATGTTCCATCATCGATCGATCTACACATGCATCACCCGGTCGAGCACGTAGAGGAGGAAGTAGGCCCAGAGGACGCCGGAGATGCCGC
CGAAGAAGAAGCCGCCGGTGAACTTGGCCCAGCCGTCGGCGGTCTGCAGCTTGTCGGCCTCCTTCTTGCGGCCGGTGAGCGTCAGCGTCGGC