Detailed information on CNT30578376


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001336, E-value = 5e-115

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692791Oryza barthiiOryza sativa76.4896.4694.7491forward
CNT30370125Oryza barthiiOryza glumipatula35.6765.9997.82229forward
CNT30102163Oryza barthiiOryza rufipogon50.6234.3295.08325forward
CNT30117593Oryza barthiiOryza nivara39.5625.4394.88254forward

Expression of CNT30578376

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MDLYIKLSVCVPRLIPGRGFYAQISSEITSEFPGVTNAHRPRRFA*

Sequence

>CNT30578376
TTTTTCAGTTTTTTTTAATAGATTAAATCTTCGGAAATTCATAACTAAATCATCGTAACTCGGATTCGAGTGGTTCAAGTTGCTAAATTCATCTAAAATC
AAGATCTACATGTTAAAAATATCCACATGTACTGTTTATGCTTGTTTTTGTACTGTTTTGTTGATTTTGTTCTTTCGCTTTAGTTTCTGACGTTCCGGAG
GAGAGCGTTTTCGTTGAGGAAGGTTCAGAAGTGTTTGCGGAAGATCAAGTTGAAGAAAAAGGATCCAGAAGGAGAAGACGTTTGGCTTATACCCCAGTTG
AGCTGCCTGTGGGAGTGGAGCTGAAGCCATCGCTAGACCGTTAATTCCGCTGCTGTTGTTTTTCTTTTCTTTTCTAAGTATGTAACGTTATTATTAAGAT
GGATTTGTATATTAAATTGTCAGTTTGTGTACCTCGGCTGATTCCTGGACGAGGATTTTATGCACAAATTAGTTCGGAAATTACTAGTGAATTTCCGGGC
GTGACAAACGCGCATCGGCCTAGGAGATTTGCTTAACTCCAATGTAGGTCTAAAAGAATCACCTTCGGGTTCTGAGCGTGCCAGATGGTTTGATCCTGCA
ACCAACAAGGTAGAAAACAACAAAGAGTTAAATCCATCAATG