Detailed information on CNT30578372


BLAST search results

BLAST vs Swiss-Prot:
sp|Q84N29|NLTP3_WHEAT, E-value = 5e-24

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697225Oryza barthiiOryza sativa56.1175.3491.79767forward
CNT30677319Oryza barthiiSetaria viridis7.939.5687.96108forward
CNT30524578Oryza barthiiSetaria italica8.0526.3888.18110forward
CNT30555882Oryza barthiiOryza glaberrima19.2492.9397.34263forward
CNT30136754Oryza barthiiLolium perenne7.946.5586.11108forward
CNT30342139Oryza barthiiEragrostis tef6.827.6887.193forward
CNT30367194Oryza barthiiSorghum bicolor4.3925.3288.3360forward
CNT30597256Oryza barthiiOryza meridionalis21.2156.8697.93290forward
CNT30371462Oryza barthiiOryza glumipatula81.9367.0392.411120forward
CNT30104065Oryza barthiiOryza rufipogon14.6393.4698200forward
CNT30118058Oryza barthiiOryza nivara14.4136.8984.77197forward

Expression of CNT30578372

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MKNYSIIDLMKLRWYCKYYYFSIELVQLRVV*

>peptide 2 (67 aa)
MIYLLQSVERLMGKPTLTPHLPGTPATVPRLSDLMLPASPLTPLQHPCVSPLLPVTYEMHGAIADPT*

>peptide 3 (29 aa)
MHIYRKLVILWENVSYLEKYLIVAFMPPT*

Sequence

>CNT30578372
ATGCAATTCATAAAACGTATAGGATTACACGTACGCACAGATCGTGTACATACTGAAGAAAATTAAGATAGAACATGCACACAGGGAGCGTGCAACATAA
AGTATACAGCTGATACAGAGAGAGAATGGAGCGCTGCATGTCTGCCGCAGCTGTTATTTTAATTACTTTGTTCATATATGCTGTAGCAAGTACGTGCTTA
ATTACTAGCTGATCAACTCCGATTGAGCTAGCATGTTAAGCTCGATCGATCGATCCAAGCAGGATTGATCTAACTAACCCTGCACCAAAGAAAAAAAATG
CATATATATAGAAAGTTAGTTATTTTATGGGAAAATGTTTCATATCTCGAGAAATATCTCATTGTTGCTTTCATGCCCCCCACTTAAATAGCCATTAAAA
AGTAAAACAAAATGATAAGCTAGATTAATATTAAATATACATGTCCATAAATATACATATTTAAATTCAACTTGTACTTGCAACAAAAATAACGGATATA
ATAGCGAAAATACGTTAAGTAGTGTTAGTTTAGTTTGTTGTTTTTCTAATTAACTTGTATAAGTTGAATTTAATCTTTTATGTCTATGAAGTGAGATATA
TCTCACATATGATAATCTATTTTAACTTGTAAAAGTTTTTATTAACTATTACTCTGTTTTAGGTTATAAGACGTTTTGACTTTGGTCAAAGTCAAACTAT
TATAAGTTTGACTGATTTTGTAGAAAAAAAGTAGTAACATTTTTAACCCAAGACAAGTATATTATGAAAAATTATTCAATTATAGATTTAATGAAACTAC
GCTGGTATTGTAAATATTATTACTTTTCTATAGAATTAGTTCAACTTAGAGTAGTTTGACTTTAACTAAAGTTAAAACGTCGTATAACCTGAAACGGAGG
AGTATTTAGATAGCACTAAAAAATAAAGAGATATATGTGTGTATATATATAGAGAGAGAGAGAGAGGGGACGTCATAATAAAGAGAGATGATATACTTGT
TGCAGTCGGTGGAGAGGCTGATGGGGAAGCCAACGTTGACGCCGCACTTGCCGGGGACGCCGGCGACGGTGCCGAGGTTGAGCGACTTGATGCTGCCGGC
GAGCCCCTTGACGCCGTTGCAGCATCCCTGCGTCAGCCCGCTCCTCCCCGTCACGTACGAGATGCACGGCGCGATCGCCGATCCCACCTGACCGCACGTG
ATCGCCGCCGACGCCCCCGGCGCCGCCACCACCATCGCCACCACCATCACCGCCACCACCACCTTACCGTTCAAAGCCGCCATATTCAAGATTACTGATT
TGATCGTCGGATGATCGATGATCTGATGATCGAGTAGCTAAGCTAGCTAGCTAATCGTCGCCGCCGG