Detailed information on CNT30578321


BLAST search results

BLAST vs Swiss-Prot:
sp|P93596|CP51_WHEAT, E-value = 2e-84

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30524412Oryza barthiiSetaria italica42.6150.2380.37219forward
CNT3080273Oryza barthiiBrassica juncea28.9934.6582.55149forward
CNT30151037Oryza barthiiBrachypodium distachyon44.7549.2588.7230forward

Expression of CNT30578321

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MWPFGMSNSLPSFVVTEKSLCDRASVLSSK*

>peptide 2 (42 aa)
MSRRCGPSGCRTLCHPSLSLRSRCVIELVCCPANSAAISRPVI

>peptide 3 (72 aa)
KRREKRRKARQASTPKVEGGILVVDDELPPLEVDHHLVLDADDHGFPVGLREGGDQLELKVPQQVSPYGLDL*

Sequence

>CNT30578321
GAAAAGAAGAGAAAAAAGGCGAAAAGCGCGACAAGCATCGACTCCTAAGGTTGAAGGTGGCATCCTAGTTGTTGACGACGAGCTTCCGCCGCTTGAAGTT
GACCATCACCTCGTCCTTGATGCCGACGACCATGGCTTTCCAGTTGGTCTCCGGGAAGGGGGAGACCAGCTCGAACTCAAAGTTCCTCAGCAGGTGAGTC
CATATGGCCTTGATCTGTAGGTAGGCGAAGGGCTCACCGAGGCAACCGTGCCTGCCGCCACCAAAGGAGATGTACGAGAAGGCGCCCGCTGCCTTGTCCT
CCTCCCTGCCTGGTGCGTAGCGGTCGGGGTCGTATGAGTCGGGGTTCTTGAAGATGTGAGGGAGCCTGTTGGCGAAGGCTGGAGATGTCGCGACGATGTG
GCCCTTCGGGATGTCGAACTCTTTGCCATCCTTCGTTGTCACTGAGAAGTCGTTGTGTGATAGAGCTAGTGTGCTGTCCAGCAAATAGTGCTGCAATAAG
TAGGCCGGTTATTT