Detailed information on CNT30578297


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001400, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30604071Oryza barthiiOryza punctata26.0886.986.93199forward

Expression of CNT30578297

Peptides detected in this lncRNA

>peptide 1 (29 aa)
LCWNTTCSFFRLVFLLSHFSISLLLWFIW*

>peptide 2 (98 aa)
NSAGTPLAPSSGWSFCYLTSASPCCFGLYGKISENLDWHLDLLLPLVFLEFILLLDFCSILLELLMVASPTTPLTSHSLTLASPGCTHKAATAVVKHG*

>peptide 3 (31 aa)
TLLEHHLLLLQVGLSAISLQHLLAALVYMVR*

Sequence

>CNT30578297
AACTCTGCTGGAACACCACTTGCTCCTTCTTCAGGTTGGTCTTTCTGCTATCTCACTTCAGCATCTCCTTGCTGCTTTGGTTTATATGGTAAGATAAGTG
AAAATCTTGATTGGCATCTGGATTTGCTACTTCCCTTGGTTTTCCTGGAGTTTATCCTCTTGCTTGATTTCTGCTCCATCTTGCTTGAGCTACTAATGGT
TGCTTCTCCTACTACTCCTCTGACCTCTCATTCACTCACCCTAGCCTCTCCTGGCTGTACACACAAGGCTGCTACGGCTGTGGTGAAGCATGGGTGAGAT
GTTGAACTACTGATCTGCTAGCTGTGATTATTTCTCTTTAGCTTGAGTTGAATTCCTAGCTGAACTGCTGGTGTTAATTTCCGTTGCGGCAGCTGCTGCT
GTTGCTCTACTGCGGCAGGTGCTTGAGGTGGTTTTCCAACCGATGCAACCGAGGCTGGGGTTCACTGAATAGCTTGGTTGATGTATATGTGAATTTGGTG
AAGACTAGGTGACTCACCTACTTTAGTTTTGATGGTTGTTTACTGACTGACACCTAAGCAGTGCTTGATCGGTGGAGTAATGTGGGATTTCACTAAATTT
TTTCTAGTTAGATAAATTCTGATACAATTAGGTACTTTTACACTTGAGTCCCTCGGGGTCTCTAAAATTGAAGGTTACTCTGAGATTAGGGACTGATTTG
TAATTGTTCTAGAACTCAAGAGTTTTTCTGAAAACTAAATGATTATTGAATCTTTGACTGAGA