Detailed information on CNT30578259


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697117Oryza barthiiOryza sativa99.474.7493.621160forward
CNT3068286Oryza barthiiLeersia perrieri20.4813.9684.94239forward

Expression of CNT30578259

Peptides detected in this lncRNA

>peptide 1 (64 aa)
MISSIFIDRWINFFGVQSRNAYPSISIQLFYEYIEPHKNCREYFRHVYIYICYTIVLAILNICF*

>peptide 2 (44 aa)
MLFLVLAICSFMICKKIKCKLKWHSRIMYLYQLIRSIEVSKLCS*

>peptide 3 (61 aa)
MLYYCLGHIEYLLLTISPSTQVNCRNTRGPTGAQVLLLMDLQALHQGALKIVALCFLLLQG*

>peptide 4 (31 aa)
MATGVMQHTLFVGCWNFIFQIYRLTDCFFVI*

>peptide 5 (42 aa)
ALVSTSTYYIQSDVKRHGFLGSLSPLKAISWRFDVHHCCLRN*

Sequence

>CNT30578259
AGCATTAGTTAGTACTTCTACTTACTACATTCAAAGTGATGTTAAACGGCACGGCTTTCTTGGATCTCTCTCTCCCTTGAAGGCTATCTCATGGAGGTTT
GATGTACACCATTGTTGCCTAAGAAACTGAGAAAGCCTTCAGGGGAGGAGAGAAGCCAAGCAAGCCACAGTGTCTAAATTTGCATCCTTGCAATTAGCTC
AAGAAACAAGAAATGTTGCATGGCTACTGGAGTTATGCAGCATACTTTGTTCGTTGGGTGTTGGAATTTTATTTTTCAAATATATAGATTAACTGATTGT
TTTTTCGTAATATGATAAGTTCAATCTTCATAGACAGATGGATTAATTTCTTTGGAGTGCAGTCAAGAAATGCCTACCCAAGTATTTCTATCCAATTATT
TTATGAATACATAGAACCACATAAAAACTGCCGAGAATATTTTAGACATGTATATATATATATATGTTATACTATTGTCTTGGCCATATTGAATATTTGC
TTTTAACCATCTCCCCAAGTACGCAGGTAAACTGCCGGAATACTAGAGGACCAACAGGTGCCCAAGTTTTGCTGCTGATGGATCTGCAAGCATTGCATCA
AGGTGCTCTAAAGATAGTAGCACTCTGCTTCCTTCTGTTACAAGGTTGATCATGATCAGTATGAAATTGTAGGTGCACTACAATAACATTGTGTTAGTTG
GCTAATTAGCGCCGAGCTTTCTCGCTAAATGCATTACAACTCAACTTAATCAGTTTCTCACCTCAGGTTACTTTATGCATATGGGGTGCTTGTTGAACTG
CATGCTAGTAAAATAGCCATTCTTGGGCAAGTGGTATGAAAGGGACAAGCTGATCGTTGGATTCAGTCAGATACCAAATTGTGAAGGCAACAAGCAGCAA
CTCTCTTAGTTGTTCATTTTAGCCCATAATCCAGCGAAGCAACTTTCTTGGTTCATGCTGTTCCTTGTTTTGGCTATATGTTCTTTCATGATATGTAAAA
AGATTAAATGTAAGTTGAAGTGGCATAGCAGGATTATGTATCTCTACCAACTAATTAGGTCAATAGAAGTGTCAAAATTATGTTCTTAGCTGACACATAG
TACCTCATAATGTCTCATTTCTCTCTCCCACTGAAACAGTTGAATATTTTTTTTTGTCAGGCAACAC