Detailed information on CNT30578248


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001292, E-value = 0.0

Expression of CNT30578248

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MLKFHTLSASYTKRAECVEPQGCRQVNILWSCDLLLCRSCAVRGLVCFVRTN*

>peptide 2 (50 aa)
MLHCHGLLLCCILRWLVVLCLCNSYLIPFALCSMQSFSISTVGWRPSAQV*

>peptide 3 (54 aa)
MPYIILVELFEVCKCFLLFRLLLKFEAFTLVKCFHCFRFDALSVSLIVMLFALL*

>peptide 4 (32 aa)
MMKLRTCLVIYKYYRLDLKRVVAELWHKILFP*

>peptide 5 (33 aa)
MWPATVVGGMIFCMPLTSNAMAYVNVCKTTRNL*

>peptide 6 (33 aa)
ALNLAMKVWISDVALPWAIAVLYSPLVSSSLSL*

>peptide 7 (42 aa)
MVRGRRLMIWPMQISTKIPTPIMLCLGTLQFAPVELEISTNC*

Sequence

>CNT30578248
TGCACTCAACCTCGCCATGAAGGTCTGGATCAGTGATGTTGCATTGCCATGGGCTATTGCTGTGTTGTATTCTCCGTTGGTTAGTAGTTCTTTGTCTCTG
TAATTCATATTTGATTCCTTTTGCTTTGTGCTCGATGCAATCCTTCTCCATCTCCACAGTGGGTTGGCGCCCTTCTGCTCAAGTTTGAAGCTCCGCTGCC
GTGCGGCGCCGACACTGTTTCGCAATTGCAGATGTGGCCAGCAACAGTGGTCGGAGGTATGATATTTTGCATGCCTCTTACAAGTAATGCTATGGCCTAT
GTAAATGTCTGCAAGACTACAAGGAATCTGTGAATCTATCCTGCTCTGCTGAGGGATTCTTTATTTTAGTACAGTAGAGAACTGAGATCAGTGCAAATTG
AGAATTCAGGCTCTATTTCTGCTCCTTAACATCAGAATTGAAGTTATGTGGCAGATTGTGTTAGAACAAAAACCTTCAGAGAAGCTCAACATTTACTAAT
AGAAGTACGTTTTTGGACTTGTGATGCTTCTGGTGAGGTTTTTGGACTAGACCAACCAATAGCATTTAGGTTGTTGGGCTCGGTGAGATCATTACAAGCA
CTTGAAGGTGTGGCTAAGTAATTGGATGATTCACTGTGGTGCTGATGCAAGTCAGCATTGGTAGTCTTTGAAGATGCAGAATGAACTCTACTAATTTAGG
GCTAAGCCATGCTGATTTAAACTGATATATATTTAGTGCTCCTATAGCAATTGGTGAAGAAATTGTGTGGAAGTTTCTGTTACAATGATGAAATTAAGAA
CATGTTTGGTAATATATAAATACTATAGATTGGATCTGAAACGTGTTGTGGCTGAGCTATGGCACAAAATCCTCTTTCCATGAATTGAACACATAATGGT
TAGAGGTCGGAGATTAATGATATGGCCTATGCAAATATCTACCAAGATTCCTACACCCATCATGCTCTGCTTAGGGACACTGCAATTTGCTCCAGTAGAA
CTTGAAATCAGTACAAACTGCTAAGTGGGCTAATTGCTATACTCTTTCACTTTCTACACAATTTTCTTTGGTGATTGACATTACATTTTTTATTTGTTCT
TCGAAAGAAAAATGAACCTTTCAGTTCCTTTCCATGCTGAAATTTCATACGTTGAGTGCCAGTTACACCAAAAGAGCTGAATGCGTGGAGCCACAAGGTT
GCAGGCAGGTCAATATACTTTGGAGCTGTGATCTGTTGCTCTGTAGATCCTGTGCAGTCAGAGGTTTGGTTTGCTTTGTAAGGACGAATTGATTTTTTGA
AACTAGAAACTCAAGTGAATTTGGCACACACCATTATATTGTTCTTATTTTGCATCTGATTTTGAGGTGAAGTTCACTTGGTCAGTTAAGTTATAGCCAC
CAAAGGTTCCATATCAGATTCCACATATCTAAATGCTCATTTATATTACATGAAATACTTCATGAACCATTTGTGCATTTTGTAGGTTGTACAACTGGAA
CCTTCCATCCCATAATTATGGATATGAATTGGTAAATAACTCTGTAAATTAAAGAAAAAATTCCTTTTAAGCTTTTGTACATAACTCTGTAAATATTTTC
GTGTCAAAAATTACAGATGGTGATAGTGAAATTATATACAATTGCGGATGTGATAATATGCCTTATATAATCTTAGTAGAGCTTTTTGAAGTATGCAAAT
GTTTTTTACTGTTCAGGCTACTCCTGAAGTTCGAAGCCTTCACATTGGTCAAATGTTTTCATTGCTTTAGATTCGATGCTCTCAGCGTCTCTCTCATAGT
CATGCTATTTGCTCTGCTTTGAAGCTACATAGCTCTTAATGAAATGTTTCCCTATTACCATCTATAAGCTACATAGCTCTTAATTAATGAACGGTAGGGC
GCCACAAAGCGCGCCTAAAAGTCCTAGTATTTATTTAATGTGAGCATATATGGTGGAAGAGAACTAAGAAACACCCAGACTTTAAGTCCCACATGCATAG
AAAACGAGGACTTAACTACCTATCAATGTCTGCATACATGCATTCCTAAATGCAATATAAGCTACATGTCAAACGAAGAGTCCAGGGTTATATGATGAAT
GATGATTAATATAGAATAGAAGGAGTATTAGTTTTGAGGATTTTGTAGGATCGGACTGTAAGAACTAAGTTAACCAGAAGGGGTGAATGGTTGAAGTACC
AAAAAACTGAAATTTTTAGCAGAACTAAAAGTTACACAATATCTCCATCATATGCCATATGGAATCTTCACTAACCACGTGCATTGATCGTTAGCCTAAG
CATCTTGCATTATATCTTGATCGTCTGGACGTCATCTTCTCCCAAGTTGACTCCTGATTCATCATTGGCAACGCTCTTCTGAGGCAAATCACTTACACAT
GCACCAACCAAGAAACCATATCTGAGTGCAAGTTCTCACCAACTTGACTCACTAATAGCAAATAACAATATTACACACATAGTATCTATCTAGAAATCAT
AAATATGAATTATCCATAGATATCTAAAGAATCGATCCTAAACTGAAACCAACACAACGTCGGTCGGTCAGACCGCTCACATACGTTGGTCTGATAGGC