Detailed information on CNT30578166


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697227Oryza barthiiOryza sativa30.8543.42100211forward
CNT30555405Oryza barthiiOryza glaberrima47.222599.69323forward
CNT30371329Oryza barthiiOryza glumipatula30.8525.4898.58211forward
CNT30106601Oryza barthiiOryza longistaminata47.0836.6397.2322forward
CNT30104147Oryza barthiiOryza rufipogon30.8523.81100211forward

Expression of CNT30578166

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MTDWKICTRQRCLPVTGYNYTLACGDPHL*

>peptide 2 (29 aa)
RRRWRWAAAQRRVAAALVRRRSGEVVRRR*

>peptide 3 (32 aa)
MHPSKVSTCDGLQLHIGLWRSSPLTGRKIRTRQ

>peptide 4 (53 aa)
RGGGGGGRRLSGAWRRRWCEGEAARWCGGARRPAVAAMLQVIDYKFLNRVWSC*

>peptide 5 (68 aa)
MQCLKPCSFPVVFSFVVCFSVPIVNLVSSSASCHLLKGISLKCLGLIISSSASITNFLWLQLGTIFLR*

>peptide 6 (33 aa)
MMCCQWRLIDSRRRPLNFCLVFLEDTRDVFIVM*

>peptide 7 (46 aa)
EAAVAVGGGSAARGGGAGAKAKRRGGAAALGGQRWRRCCKSSITSF*

Sequence

>CNT30578166
AGAGGCGGCGGTGGCGGTGGGCGGCGGCTCAGCGGCGCGTGGCGGCGGCGCTGGTGCGAAGGCGAAGCGGCGAGGTGGTGCGGCGGCGCTAGGCGGCCAG
CGGTGGCGGCGATGTTGCAAGTCATCGATTACAAGTTTCTGAATCGGGTGTGGTCTTGTTGAAGCCCCATGATGTGTTGCCAATGGAGATTAATTGATTC
TAGAAGAAGACCTTTGAACTTTTGTCTTGTTTTTCTTGAAGATACTAGAGATGTTTTTATTGTGATGTAGCTAGAAAATTAGAATCTTAACATTTTCCCT
GAAATGCAGTGTCTCAAACCTTGTAGTTTCCCAGTAGTTTTTAGTTTTGTAGTTTGTTTTTCGGTTCCTATTGTAAACCTTGTAAGTTCTTCGGCTTCTT
GCCATCTTTTGAAAGGAATTAGTTTGAAATGTTTGGGGTTAATTATTAGTTCTTCGGCTTCTATTACCAATTTTCTATGGTTGCAACTGGGCACCATTTT
TTTAAGATGACTTTCTATTCCTGTGATGGGTTCATATCTTGAACTCATTGGAGGTGAGTCTCAGGTATGACGGATTGGAAAATATGCACCCGTCAAAGGT
GTCTACCTGTGACGGGTTACAACTACACATTGGCTTGTGGAGATCCTCACCTTTGACGGGCCGGAAAATACGGACCCGTCAGAT