Detailed information on CNT30578138


BLAST search results

BLAST vs Swiss-Prot:
sp|P10707|CB2D_SOLLC, E-value = 5e-24

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697144Oryza barthiiOryza sativa97.5100.7497.07818forward
CNT30249379Oryza barthiiAvena sativa25.2753.493.87212forward
CNT30135675Oryza barthiiLolium perenne20.3845.1290.64171forward
CNT30597100Oryza barthiiOryza meridionalis43.1549.2596.96362forward
CNT30371256Oryza barthiiOryza glumipatula100.3676.8998.93842forward
CNT30104243Oryza barthiiOryza rufipogon51.6180.19100433forward
CNT30117952Oryza barthiiOryza nivara100.4867.8298.93843forward

Expression of CNT30578138

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MKNPSMENMASRPFLISFTFSSAAWSGSLASPSGSNGPPGWSLSSRSCTTIAIAGESPVSISEQNQQV*

>peptide 2 (46 aa)
FLSEDQNEQVFKFISQLDDNLHVHLTHSSTLLKLLPSSSRVRLKLT*

Sequence

>CNT30578138
CCTTCCTATCAGAAGATCAGAATGAACAGGTTTTCAAATTCATCTCCCAACTCGACGATAATTTACACGTACATTTAACACATTCTTCCACCCTTCTCAA
ACTCCTCCCTTCTTCTTCCCGGGTAAGATTAAAATTAACTTGAGGCCAGCCAGCGTCGCCGGCGGCGAGATGTTTACAGGCTGGGCGTCCTCTCGGCGGC
GCCGGAGATGACGGTGAGCAGGTTCTCGACGGGGCCCTCGCCGGTGACGTAGGCCTGGATGAAGAACCCCAGCATGGAGAACATGGCCAGCCGCCCGTTC
TTGATCTCCTTCACCTTCAGCAGCGCCGCCTGGTCCGGGTCGCTCGCCAGCCCCAGCGGGTCGAATGGGCCACCTGGGTGGAGCTTGTCCTCCAGATCCT
GCACCACCATCGCCATCGCCGGCGAATCTCCGGTGAGTATCAGCGAGCAAAATCAACAAGTGTAGACTAACTAAGGTCCCGTGTTTGAGTTCATCGAAGA
TAAATTAAGGGTACTTCAAATGAGAAAGCTATTAGCGTTTGATTAATTGAGTTCTAATTACTTTAAGTTTGAAAGAGGATTTAAAATTTTTATATAAAAA
GTTCTCGTACGAAATACACCATTCAACAAATTGGAAAGCGTGCTACCGGAAACAAAAAAAATGTAAGACTAATTAAGTTTTAATTATTTTAGATTTGGAA
AAGGATCTATATGATATTTTAAAGCAATTTTCATATACAAAGTTTTCGTACGAGATATAACATTTAACAAATTGGAAAGCGTGCTACCGGAAACCAAAAG
GTGTAAGACTAGGGCGTGTAGATTGTGCAGTTGACTGAC