Detailed information on CNT30578126


BLAST search results

BLAST vs Swiss-Prot:
sp|P10707|CB2D_SOLLC, E-value = 2e-29

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677012Oryza barthiiSetaria viridis30.436.3191.8256forward
CNT30524410Oryza barthiiSetaria italica30.432.7491.8256forward
CNT30184672Oryza barthiiSecale cereale16.5142.1293.53139forward
CNT30295002Oryza barthiiTriticum aestivum28.7446.993.39242forward
CNT30390869Oryza barthiiTriticum turgidum19.3634.6894.48163forward
CNT30555402Oryza barthiiOryza glaberrima58.3161.07100491forward
CNT30438779Oryza barthiiAegilops tauschii22.830.4391.67192forward
CNT30664041Oryza barthiiTriticum dicoccoides23.5252.893.94198forward
CNT30465769Oryza barthiiSaccharum spontaneum30.054490.91253forward
CNT30137065Oryza barthiiLolium perenne24.1144.4294.09203forward
CNT30353507Oryza barthiiEragrostis tef24.5816.294.2207forward
CNT30365046Oryza barthiiSorghum bicolor30.0526.2791.7253forward
CNT30481599Oryza barthiiChara braunii12.1122.9787.25102forward
CNT30151052Oryza barthiiBrachypodium distachyon13.4248.7192.04113forward
CNT30498372Oryza barthiiDigitaria exilis25.344.8492.49213forward
CNT3039554Oryza barthiiMarchantia polymorpha11.6426.7893.8898forward

Expression of CNT30578126

Peptides detected in this lncRNA

>peptide 1 (35 aa)
KFISQLDDNLHVHLTHSSTLLKLLPSSSRVRLKLT*

>peptide 2 (68 aa)
MKNPSMENMASRPFLISFTFSSAAWSGSLASPSGSNGPPGWSLSSRSCTTIAIAGESPVSISEQNQQV*

Sequence

>CNT30578126
TCAAATTCATCTCCCAACTCGACGATAATTTACACGTACATTTAACACATTCTTCCACCCTTCTCAAACTCCTCCCTTCTTCTTCCCGGGTAAGATTAAA
ATTAACTTGAGGCCAGCCAGCGTCGCCGGCGGCGAGATGTTTACAGGCTGGGCGTCCTCTCGGCGGCGCCGGAGATGACGGTGAGCAGGTTGTTGCCGAA
GGGGTCGCTGAGGTGCTTGGAGAGGTTCTCGACGGGGCCCTCGCCGGTGACGTAGGCCTGGATGAAGAACCCCAGCATGGAGAACATGGCCAGCCGCCCG
TTCTTGATCTCCTTCACCTTCAGCAGCGCCGCCTGGTCCGGGTCGCTCGCCAGCCCCAGCGGGTCGAATGGGCCACCTGGGTGGAGCTTGTCCTCCAGAT
CCTGCACCACCATCGCCATCGCCGGCGAATCTCCGGTGAGTATCAGCGAGCAAAATCAACAAGTGTAGACTAACTAAGGTCCCGTGTTTGAGTTCATCGA
AGATAAATTAAGGGTACTTCAAATGAGAAAGCTATTAGCGTTTGATTAATTGAGTTCTAATTACTTTAAGTTTGAAAGAGGATTTAAAATTTTTATATAA
AAAGTTCTCGTACGAAATACACCATTCAACAAATTGGAAAGCGTGCTACCGGAAACAAAAAAAATGTAAGACTAATTAAGTTTTAATTATTTTAGATTTG
GAAAAGGATCTATATGATATTTTAAAGCAATTTTCATATACAAAGTTTTCGTACGAGATATAACATTTAACAAATTGGAAAGCGTGCTACCGGAAACCAA
AAGGTGTAAGACTAGGGCGTGTAGATTGTGCAGTTGACTGAC