Detailed information on CNT30578098


BLAST search results

BLAST vs Swiss-Prot:
sp|P0C5B3|MT1A_ORYSJ, E-value = 8e-19

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555477Oryza barthiiOryza glaberrima97.7788.2499.65570forward
CNT30107782Oryza barthiiOryza longistaminata65.3583.1993.96381forward
CNT30104275Oryza barthiiOryza rufipogon100.3479.8198.97585forward
CNT30117926Oryza barthiiOryza nivara85.0897.4598.79496forward
CNT30558796Oryza barthiiPanicum hallii21.120.1387.8123forward

Expression of CNT30578098

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MMSTMHSLRVLLASYRTGSRPAGKEAYITTAL

>peptide 2 (62 aa)
MVDAGRHLNSCKGCTCSWNRSCSHGRSRRTLRPPQTAAPSSPAPHPARRWPWCCCSSLPGAV*

>peptide 3 (96 aa)
MQAGILTVARVAPAAGTAAAAMGGLAGLCGRLKLLRLLLRRHTQHDGGLGAAALLFQEQFEPQLQLDPQLQDIFSQSVIKLKQLKMKSTKEKKKSF*

Sequence

>CNT30578098
TTAATATATTCATCACTTCATCTGTGGATACACCATTACAAGCATAGTACGTTAATAGTGAAACCAATAACATAGCACATCGATTAACCCATCACACACA
CACACACCATATATATTGGTCAAGCACCAACCCAAATGGCCAAGCTTCTTTATTTTTCTGCATCACAATTCACACGCACACATGATAGATGGTAGATGCA
GGCAGGCATCTTAACAGTTGCAAGGGTTGCACCTGCAGCTGGAACCGCAGCTGCAGCCATGGGCGGTCTCGCCGGACTCTGCGGCCGCCTCAAACTGCTG
CGCCTTCTTCTCCGGCGCCACACCCAGCACGACGGTGGCCTTGGTGCTGCTGCTCTTCTCTTCCAGGAGCAGTTTGAGCCGCAGCTGCAGCTAGATCCAC
AGCTGCAAGACATCTTCTCTCAGTCTGTAATTAAGCTAAAGCAACTGAAGATGAAATCAACTAAGGAGAAGAAGAAGAGCTTTTGAGATGATGAGCACAA
TGCATAGCCTTCGGGTCCTCCTCGCTTCTTATAGGACTGGATCGAGGCCGGCCGGCAAAGAAGCGTATATTACCACGGCGTTG