Detailed information on CNT30578076


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9LHA8|HS704_ARATH, E-value = 5e-85

BLAST vs NONCODE:
NONVVIT003131, E-value = 2e-62

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696916Oryza barthiiOryza sativa39.4391.3598.74317forward
CNT30522726Oryza barthiiSetaria italica59.8358.1686.49481forward
CNT30535317Oryza barthiiEucalyptus grandis63.4389.9586.08510forward
CNT30515289Oryza barthiiJuglans regia27.3645.9382.27220forward
CNT30490395Oryza barthiiOlea europaea52.9953.3885.68426forward
CNT30225079Oryza barthiiHordeum vulgare16.6749.4584.33134forward
CNT30383257Oryza barthiiTriticum turgidum5162.0387.56410forward
CNT30568743Oryza barthiiActinidia chinensis16.0441.3586.82129forward
CNT30613976Oryza barthiiArabis alpina53.2361.1485.28428forward
CNT30450032Oryza barthiiSaccharum spontaneum65.0565.2985.28523forward
CNT30138690Oryza barthiiLolium perenne27.9946.9790.22225forward
CNT30625111Oryza barthiiDaucus carota41.4232.9183.48333forward
CNT30361391Oryza barthiiSorghum bicolor52.7450.6687.03424forward
CNT30595552Oryza barthiiOryza meridionalis8.7130.9792.8670forward
CNT30369874Oryza barthiiOryza glumipatula31.3456.7695.63252forward
CNT30154479Oryza barthiiPrunus persica2648.1686.6209forward
CNT3056582Oryza barthiiAmborella trichopoda17.6622.0284.51142forward
CNT30496988Oryza barthiiDigitaria exilis54.645.9288.84439forward
CNT30550306Oryza barthiiOryza brachyantha20.0239.7585.71161forward

Expression of CNT30578076

Peptides detected in this lncRNA

>peptide 1 (32 aa)
NSKRLPKQTKGIIIAAKFFNTQHQRDTNNAIR*

>peptide 2 (82 aa)
MVILFFCPVVLSSADTFRIPLASMSKQTVICGEDLLLLDGHDTTSSLQTERERGNIQQEEVLDLLVALTTQDGSLDSSTISNS

>peptide 3 (39 aa)
MTPPAVSKPRERGVTSNRRRSWTFSLPSPLKMAAWTAAP*

>peptide 4 (46 aa)
MPPAMSAPAPWYILAMMGLQMPSSSFILSSNSSASASWLPSSHWMA*

Sequence

>CNT30578076
AATTCAAAAAGACTGCCCAAACAGACCAAGGGTATCATCATAGCAGCAAAGTTTTTTAACACGCAACATCAAAGAGACACTAATAATGCAATAAGATAAC
TTGAAGCGCGGATCACTAGCAAATTTCGCGCTTAGTCGACCTCCTCGATCTTGGGGCCAGCACCGCTGCCGCCAGCCGGGGGAGCATCGTCCTCGTCCAT
GCCGCCGGCCATGTCCGCGCCAGCGCCCTGGTACATCTTGGCGATGATGGGGTTGCAGATGCCCTCCAGCTCCTTCATCTTGTCATCGAACTCATCAGCC
TCGGCGAGCTGGTTGCCGTCCAGCCACTGGATGGCCTGATCGATGGCATCCTCGATCTTCTTCTTGTCCGCTGCCGGGAGCTTCGAGGCGATCTTCTCAT
CCTTGATGGTGTTGCGCATGTTGTAGGCGTAGTTCTCCAGCGCGTTCTTGGACTCCACCTTCTTCTTGTGTTCCTCATCCTCTGACTTGTACTTCTCGGC
CTCCTGGACCATCTTCTCAATCTCCTCCTTGCTGAGCCTGCCCTTGTCGTTGGTGATGGTGATCTTGTTCTTCTGCCCGGTGGTCTTGTCCTCAGCAGAC
ACGTTCAGGATACCATTGGCATCAATGTCGAAGCAAACAGTGATCTGTGGAGAAGACCTGCTCCTTCTTGACGGTCATGACACCACCAGCAGTCTCCAAA
CCGAGAGAGAGAGGGGTAACATCCAACAGGAGGAGGTCCTGGACCTTCTCGTTGCCCTCACCACTCAAGATGGCAGCCTGGACAGCAGCACCATAAGCAA
CAGC