Detailed information on CNT30577958


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30105345Oryza barthiiOryza longistaminata13.2338.5385.28163forward
CNT30103780Oryza barthiiOryza rufipogon35.6395.2399.54439forward
CNT30117747Oryza barthiiOryza nivara27.5210099.12339forward

Expression of CNT30577958

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MRFDLDFSSCSYLGNLVVKMVKSDSHKFFQWVIS*

>peptide 2 (30 aa)
MGYLLIELGLILLCYFSLAVFFICTLYFSV*

>peptide 3 (81 aa)
TAVRLRSGVRAHRPRQRAHIGGEPAMARRQQPTAGGTSPSWLPQPRAHGEPAADDSSQKILVPKIQLSLLSNLESAFLFCI*

>peptide 4 (58 aa)
MDSSFNLSPRRREILAPPLQVSVVLFALRTRDAAKKEFKLLANVSKLYMGHKQPSKGS*

Sequence

>CNT30577958
CGACGGCGGTGCGTCTCCGCAGCGGCGTCCGCGCGCATCGGCCGCGACAGCGGGCGCACATAGGCGGTGAGCCGGCGATGGCCCGACGACAGCAGCCAAC
AGCCGGCGGCACTTCACCTTCCTGGCTTCCTCAGCCACGGGCCCACGGCGAGCCAGCGGCCGACGACAGCAGCCAGAAAATCTTGGTTCCCAAAATCCAA
TTGAGTCTCCTCTCTAATCTTGAATCTGCATTCTTATTTTGCATTTGATAGTAATTAGTCAATTAGAAATTGGTTTGATTTCCTGGATGAAGAGGTTCTA
AACATTAATATCATTTCTGTCCACCCAACCCCAGAAACAACAGAAACTGATTGAGTACATCACAACACTAGAAACAGCCGGAACTGAGGATAGTAACAAT
GGGCAAAATAATGTTGTGCTTGCTCCAAATGTGATTGTTGTTGACCGGGCTGCTCACACCAATTGAACAATTGGATGTAAACATTAGGTAGAAGGGATTA
TTTGTTTGTACAGTCCTTAGAGACCAACTTGACACATTTATTTGTGACATGAGATTTGATTTGGATTTCTCAAGCTGCTCTTACCTTGGTAACCTTGTTG
TAAAGATGGTAAAAAGTGATAGTCACAAGTTTTTCCAATGGGTTATCTCTTAATTGAATTAGGCTTGATTTTGCTCTGTTATTTCAGTCTTGCAGTTTTT
TTTATCTGTACTTTGTACTTCAGCGTATGAATTATCATGGATAGTTCCTTCAATTTGAGCCCTAGGCGTCGTGAGATCCTGGCTCCGCCACTGCAAGTCT
CTGTTGTCCTCTTTGCTCTCCGGACCAGGGACGCTGCCAAAAAGGAATTCAAATTGCTCGCCAACGTCTCCAAGCTGTACATGGGCCATAAGCAACCAAG
CAAAGGTTCTTGAATTTGCAGCCGATCTCTCGCCCTTTTTAGGGTTCTATTCTTGTAGTGGTCATTTCTGTAAGTAATGCTGCCAAGAAAGAATTTCAAG
GTAGGTTCAGCAGTGCCACTGACCGGCAACATTTCAGGGTGTCTCACCAAAAGGTAGAGCATGTAGTTGGATAGTTTCCGGCACACACTGGCCAATACCT
CATGAAGAGAATAGTTCGATAGGTGCACCTCTGTAAATATATGAAAGTACACAATAGCATAGCCAAAATTCATATCAGAGTCCAGTAGTAACTTTTTCAG
CGGACCAAGATTTGGCCAGCGTTGATCATCCG