Detailed information on CNT30577878


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000921, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693123Oryza barthiiOryza sativa20.353.5787.551357forward
CNT30596548Oryza barthiiOryza meridionalis20.5475.485.361373reverse complement
CNT30369450Oryza barthiiOryza glumipatula25.1960.0883.371684forward
CNT30107694Oryza barthiiOryza longistaminata21.3595.7789.561427forward
CNT30103565Oryza barthiiOryza rufipogon31.359098.472096forward
CNT30117686Oryza barthiiOryza nivara52.21100.1498.193490forward

Expression of CNT30577878

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MNYEPICYPISASTREQLNPSHSSTKAQPQPILATYPLNQLDYSVYLLLSKKPKPTQEI*

>peptide 2 (31 aa)
MVGSSRAWQHRLLCSAQPLKMNGSLGRRPVC*

>peptide 3 (29 aa)
MHSTADKGLQSTVSVQILFMNEYRGMFQI*

>peptide 4 (60 aa)
MEQVPLMLVTEKLYHDKANVFGTSWIAGKAYIYCSMNIIKTIRIAVLAVIGHWDSQCHLG*

>peptide 5 (49 aa)
MRGIHFSPFPSSSTSESNLTGALSLLPVHDLPSAVPAISLTPFAGHCHP*

>peptide 6 (32 aa)
MWLPPGSPDSGVHRVNRQWLRSLAISVHSLNS*

>peptide 7 (44 aa)
MRTTVGASLFPRPPQHAAQLALELCVILAAPSPLTVVGVTLPPL*

>peptide 8 (48 aa)
MLLPPFHNIWKERNGRVFEGVATSSSLLCAAIEDEWESWKAAGLLTAL*

>peptide 9 (32 aa)
MMGVSQPVLSKNPGNARTPLAADNVTFRAYGD*

>peptide 10 (42 aa)
MAGYHCRRPISLTGAIPANPSRHRACLDERNPFFPFPLFLHL*

>peptide 11 (51 aa)
MDSNLWYFKHQIIRLPISDLFALEQGKLLFLSFEHNNPIFYISNIFCISHT*

>peptide 12 (57 aa)
MGTFAVYWPRRRTVGCKARQNQTQGRSAAPGTPRLDAYNGRSFTIPSTSTACRTVSS*

>peptide 13 (51 aa)
MKNDLMQLYFHLSKLSLLRICKVLSAQNNYILSILAEKQQQHSSIYALHGR*

>peptide 14 (31 aa)
MVDFWVASTVPTDIRLPSTCEEHTSTTAILV*

Sequence

>CNT30577878
CTATCCTTTGATTCCAAACCTATTCTTATTTATCGCCAAATATCTAAATTCTTCCTTTTGATCTAGCCGCTAATTTAATTCCTGTGGCTTGATTTCCTTC
TCGGCACAAGAAAAATATTATTACAAATATTGTGAATAATTGCTCTTGTGCTAAGAAAATAAATTATATCCTTATCACCTAAATTTCCTTTTAGCCTCAA
ACAATTCCTTGAAACCCATGCCATATATTTTAGGATTCAAATCCTATCCTTTTGCCTCCACCTATTTTCCTACCACATTCCCAAAAATATTTTGAGGAAT
ACTATTAATTTATTTTCCTATTTGAGTGCTTCCAAATAAATTCCCTCAAACTCCACCTCTAAATATTGCACTCAAATAAATTAGAAAATCTCCTTTTCTG
AATTCTCTCCTAATTCAAATTCTTCGCAAAACAACGTTATCCAAATCAAGTATACAAATTAGACTTCTTTCTTTTTGTCATCGAGCCGAAACTCCGTTCT
TTCTTCCTTTTGGCCCAATCCTTTTTCTTTCTATTTTCCTCCTTCCTCTTGGGCTGCCGGCCCAGCTAAGCCCGGCCCAGTTCGGCCCACAACCCAGCCG
CCTCCCTCCTCCCAGTGCGCGTGCCGTGCACGGCGCACGCCGCCGCAACCGTCGCCGCTAAGGAATCAAGTCGGCGCCGTCATCCTTCTTTCCACGCCAT
CGCCGTCGCCGATTCTCCCTTGTCTTCCTCCTCTTCGAACCGCCTCTCATCGCCTATATAAGAGGATGAACCCCCTCTGTTTATCCCCCACAAACCGAGC
TTGAAGCNCTCCTCTCTTTTCTCTCTCCTTGCCATGGCCGGCTATCACTGTCGTCGGCCGATCTCCCTCACCGGAGCAATACCGGCCAATCCCTCGCGCC
ATCGAGCTTGCCTCGATGAGAGGAATCCATTTTTCCCCTTTCCCCTCTTCCTCCACCTCTGAATCAAACCTCACCGGAGCTCTCTCTCTCCTCCCGGTTC
ACGACCTTCCATCCGCCGTTCCGGCTATTTCCCTTACTCCCTTTGCCGGCCACTGCCATCCCTAGGTGCGTTGCAGTCGGGAACACCACTGGCCGCCGGC
GTCACCGCCTCCTCGCCACCGGAGCCCGGCGCCCCCTCTCCTCCTCCTCTCTGTTCGACCGAGGAGAAAAAGAAGAAAGAGACGGGAAGAAGAAGAAGAA
GAGGAGAAAAAGAAAAAGAAAAAGGAATCCCTGACAGGTGGGCCCATGAACAGTATACTTTCGCAATTTACTCTATTTAATTCAAATTCCAATCTTTAGA
AGCCNATATNTCCTAAACCGTAGATCCGATCTCAGTGAAACCTNGANCTAAATTCATCTAAATTCAAATGCTTCATTTTGATGCCTAATTTGTTATTTTA
TAATTTTATTTGAATTTATTCAAATATCATTTGAATTTNTATTTGCCTTTTTCAAATATTTTCTTTTACCCCAAAATACCCTTTAGCCACTAAAAAGCCG
CCGGTTGGAACTTTACGCCTTCCATGGGGACGTTTGCGGTCTATTGGCCCCGACGTCGAACCGTTGGTTGTAAAGCCCGGCAAAACCAAACCCAAGGTCG
AAGTGCTGCTCCTGGCACCCCACGCCTTGATGCGTACAACGGTCGGAGCTTCACTATTCCCTCGACCTCCACAGCATGCCGCACAGTTAGCTCTTGAGCT
CTGTGTGATCCTAGCCGCTCCGTCGCCACTCACGGTTGTCGGAGTAACACTTCCGCCTCTCTAAACCTGCACAAACCTCCCATCCCTCTAGCCGTTATAT
TGTCTATCGACACCAGCTAAAGAAGATACCAAACCTAGTCGTCATGCTTTAGCGACGACTAGCGAACACCCAAACCCTAGTCGATATTTATCTTACCTCG
ATATCGGCTTAGAAAACTGAAACCTTAGTCAACTTATTTGCTAGACTCCCCACCAGCTATAATCACAACCATTTACCCGCCTACTACCCATAGCCTATGC
ATGAATTACGAGCCGATATGCTATCCTATTTCAGCATCGACTCGAGAACAACTAAATCCTAGCCATTCTTCTACCAAAGCCCAACCTCAACCAATACTAG
CCACATATCCACTTAACCAGTTAGATTATTCGGTATATCTCCTACTCTCCAAGAAACCAAAACCCACACAAGAAATATAAGCGACAATTGTTGCTTAATC
TCCTATCCACCTTAGCCCCCAACCCTTTAGAACCTGCACATAAAATATCAGCCCAGTAATCCATATACCTGCATAAAAGAGATAACCTAAACCCTAGTCC
TCCTAACCGTTTATCTCTTTCTTGCTATTTTATGGCTTTTATTGAATTTGGATCTTCCTCTTCTTCAGTAGAGTCTATTTTATATGGATAGCAACCTGTG
GTATTTCAAGCATCAGATAATCAGGTTGCCTATTTCGGATTTATTTGCGTTGGAGCAAGGCAAGTTATTATTTCTCTCCTTTGAGCATAATAATCCTATA
TTCTATATCTCCAATATCTTCTGCATTAGCCATACATGATTTTAAATGCATAACCTGAATATATAGCAAACCAGATATATGCTAGATTTTGCTTAGCCAT
GCCTAGTTAGATTATGCATAAAATATAATAAACTTAGATTGGGATAGTACGGTAGAAATGGTTGATTTCTGGGTGGCTAGTACTGTTCCAACCGACATAA
GACTACCAAGTACATGTGAAGAACATACGAGTACGACCGCAATTCTCGTATAGGCATAGACCTAGCTGATTAAGTTATCTAGCAAAGGCGGTACCTCTGT
ATAGTGGTTCTTCTTAAGTCCTCGCGTAGGAGGCAAACTTACGCCGAGCAGGGCGATTGTGATATTTACCGAGGCGCAGGTAAATATCTTAATTATCTCG
TGAGCTGTGTGTGTGAATTATGAAAACCTGATTGAGATGATGGGGGTCTCTCAACCAGTTCTCTCTAAAAACCCCGGGAACGCCAGAACTCCTCTCGCTG
CTGATAACGTTACGTTCAGAGCGTATGGGGACTAGAGTTCATGGAACAGGTACCACTGATGTTAGTGACCGAAAAGCTTTACCATGACAAGGCTAATGTG
TTTGGCACGTCATGGATTGCGGGTAAAGCGTATATCTACTGCAGTATGAATATTATTAAAACTATTCGAATAGCCGTGCTTGCGGTTATCGGGCATTGGG
ACTCACAATGTCATCTTGGTTAGAAACATAATTTCAAACTTTATTAAATACTGTTGCATTCAAAACATTATAGACTTTCCTTCTATATTCTCTGCTTTCT
GCAAGTAAATCTAACCCTACTCAAATATTATTATTTCATGCATTCATTGTTGATTAATATAATAGNTTGCTGAGTACGTTGTACTCACCCTTGCTTCAAC
CCCACATTTTTTCAGTCCGTTTGAGTTCTTACTGAAGCCGGGAGTTCAATCATATAAGTTAATCTCATTTTAACTTAGTTCTCAAGTATAGATTAGATAG
ATGGTTTAAGTCTATAGCAAAACACTAGAGTTGAGTCATCATATAGCTTCTGCTGTAATAGTTAGCCACAAGCTTGTAAATACCCTTATATTTTGTAATA
TTATCTCCTTTGAAACCTTGATCAAATGTATGCAATGAAGATCCAGATCGTTGAACATGTATCAATCTACTGATACAGGGCTTGATACAGTCTAAACATG
TCGGTTTCCGAATCATTAGTTTTGGGACCCCACACCAAATTTCTTCCTCCTTGGCATAGGTGACTTTCAATAGTCCACCAAGGAGTGATGGCAGGATAAA
AGTGACACTTCTCTACCATGCTGAACATCCCAGAAAGCTTCTCCGACCACTACATTCTATTTTGCATTGAGGTAAAGCCAGTATAGAAACAACAAGTATT
CTCACCCACTTTAGCATATTGCTAGCTTTTTTGAGTACTACAAAATTAGCTGTGTTATATATATGTAGAGTTCAGGTTACAGTTTCCAATCCAACCATAC
GCTCATTCATTTCTTCCTTAGAATGGAAATATTTGTGTTGGAGCATTTTCAGAATTCGAACAAGCAAAGTTCTGTATAGTATCACAACTACCTAGCATCA
GTGATAAATATAGATGCTACTCAAAGCTTTTTAATTAGTATAGTATTCCTTTTCACCAGAGTTGATATGGGAGAGAAATTATAGAACTCCTGAAAAGTGA
TGTGGTTTTTTATAGATGTGGGATATTTAAGTATCTTAATCTGTTGATTTAAAATTATTGTCATTGGCAAGCATTGATGATATATGTCATTGGTAAGCAT
TGATCTGATCATTGCTTAATCTCTTTTCCTTAATTTGTATTGAAANACTACTAGGAAGTATTCAATTCTTAGCNNTACTTAACACTGATCCAATACAAAG
ATGATCTGATTGTTCACCATCAAGTGAACACTGTAGTTTACCAATACACAATGTGTTGATTTCTCTACTTTCAGATATATGTGCCAAAGCAAACTTGCAA
ACAGCCTTCTGTTGTGTGTACAAGTTAATGGTAATTAAGTCTCTTCAATATATTNNGNCAGTTATNCTTNATACAATGTTCAATTGTTAATTCTCTTGAA
CCAGTTTGAGCAATTATGTATACTCAATTCAGCGGCATCATGGTCAGGCGCGGCGTAGCACGCCAATATTTCTACTATTCAGAATAGATGGTAGTAATTT
GGATGACCCCTTGCGGCGTCTGAGTTGGTGGAGAGGAAGGTGCCAATGGTCTTGACAGCCCTCGCCAAAAGGGCAAAGGGCACTGGCAGTGCTGCATAAA
TCAATAACAATACAGTACATTAGCAAAGATCAAAGCACCCAGTTACAACCACCTGATACTGGATGCGACATATTCTAGTACTACGTACGAATCAGGATAT
GCCCTAGTCTAGATTCGTAATACTATATATGCCTCATCCCGTCATAGGTTGCTATATTTTGAGATGGAGTGAGTATTGACTTGCATATTGGTTGCGTTCT
AAGTTTCAACTCCAGTCTCCAAACTATAACTTCCTCGTTTTCCGTTAGATTCCACTGTAAAAATTGATACATGAAAAAGATGTTATATAAAAAGGATATT
GTAGATTCAACATGAAAAATGATTTAATGCAGTTATATTTTCATCTAAGCAAACTATCTCTCCTCAGAATCTGTAAAGTATTATCAGCCCAAAACAATTA
CATTCTGTCAATCTTAGCAGAAAAACAGCAGCAGCACTCTTCGATCTATGCACTCCACGGCAGATAAAGGTCTTCAAAGTACAGTGTCAGTTCAGATTTT
ATTCATGAATGAATACAGAGGAATGTTTCAAATTTAACTGCAATTTTTGTAGGCAACACAGGCAATTTGGAGGCCACACAGCCACAGGTATGTAGGTTAA
TTTCACAGAGATCTCGAATAACCTACAAAGCCATTCCATCTTATTCAATTTTCTCTTTCAACCATAGGTTAATCCAAGGTTGTGAAAAAAGCATATAGAC
TAGTGGTTGTACTGACCTGAGTAATACCTAAAGTCCTGAGTTCAAATTTCGATAGGAGTGAATTACATATTGAATTATTTGATGGTTAAGTTCCCTATCT
TATAGGCTAAGTTCGTAATTTAAAAATATTGTATATATCCGGTTGGATGTAAAGGCCGGGTAAAAGATATCCTTCTTTTAAAACAAAAGTTTAATCCAAG
GCATCAAGATCAACCAGATTGGGTTATTTGAGGGCTAAGTTCCTAATTTTAAAATGTTGCATATATTCGGTTGGATGTAAAACCAGGTAAAAAATACCCT
TCTCTTAAAAAAAAAGTTTTACTCCAAGACACCAAGATCAACCTGAATTTTAATGGATCTTTAAAAAAAAGGTACTATTAGCCATGAAAGCGAGAATAGG
AGACGTGACCATATTGTAAGAAAACATAATTTCAGAAACATAGTTTGCTCTGTTCGTAAAACCTGATAACTGATCTGGCAGCGCCTATGATGCTTTATTA
GCAACCACTCTTCATGCGAAGCAAAACTGGGCCGATATCAGTACACAACGCATAACATAGTGAAACAATCAAGCAAACAGCCACACACCAATTTTCGTTC
TTCTGTTTCGTATACCAACCTTAAACTGAGGATGAGCAGCCGTGATCTGGAGGGGATCGTTGCAGCGATGGGTGACAAAGGCAGAAGCAAGAACGAAGCC
TGACGAGGTGGTGAATTCAGAAGCATTCATCTGGAGCATAATTGAAATGTTACTCCCTCCGTTTCACAATATTTGGAAGGAACGAAATGGTCGGGTCTTC
GAGGGCGTGGCAACATCGTCTTCTTTGCTCTGCGCAGCCATTGAAGATGAATGGGAGTCTTGGAAGGCGGCCGGTCTGTTAACGGCGCTGTGAGAGGCCC
TTATGTGGCTTCCTCCGGGTTCTCCGGATAGTGGTGTGCATCGTGTAAATAGGCAGTGGCTGCGAAGCCTCGCCATCTCTGTACATTCTCTAAATTCTTA
ATATACTACGGTCGGCGTTCTTTGTCGACCCGGCGAATTTATTTAACCATTTTGCGATATGAACAGTTAAAGAACAGATTTAATTAAAGGAGTATAATTA
TATAAACCCATATGAACATATGCTGTCCCAGAACACTATGCAATGTAACAGTAAGCAATCACAAATTAGTTGAACAACAGTAAAG