Detailed information on CNT30577875


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30371124Oryza barthiiOryza glumipatula79.953.4798.81085forward
CNT30103708Oryza barthiiOryza rufipogon96.3266.8497.781308forward

Expression of CNT30577875

Peptides detected in this lncRNA

>peptide 1 (72 aa)
MGNVFFIPKHPPPPPPSHVHSIHHPLSNAPSFMNSPNGFTVAHTFCIETRLPLDEEQMRELMKTIEKKKSEQ*

>peptide 2 (32 aa)
MVCSILRVAEKIDLKITSADISSWYYVGSGYF*

>peptide 3 (38 aa)
MLNLAGSGENRPQNHICRHQLVVLRRIRLFLMGPNPHL*

>peptide 4 (37 aa)
MRSPMTAFVYNPSVMRNRIVLELIGDTSLFSDLLQSC*

>peptide 5 (48 aa)
MINQLCSLASWREEIILLCIVRNKQKKTTNYIFDMIWFVSEVHSYHSL*

>peptide 6 (40 aa)
MSLALVRDFWSLMIPLIFDGDSLSEVIVTSDRPVFSGHQR*

Sequence

>CNT30577875
CAACAGGTACACAAAATACAAACACTGAGAAAGAAAGAAAGAAAGAAATAAAAGACAACTGTCGTGCATAGAGAATATCTATTGTCGATCTCTATTAATG
GGCAACGTGTTCTTCATCCCCAAACATCCTCCTCCTCCGCCTCCTTCGCATGTCCATAGCATTCATCACCCTCTCTCTAATGCTCCATCTTTCATGAATA
GTCCGAATGGATTCACGGTGGCACACACATTTTGCATAGAGACGAGGCTACCTCTTGATGAGGAACAGATGCGGGAGCTGATGAAGACGATCGAGAAAAA
GAAGAGCGAGCAGTGATACTAAGGTAGTGGCTCAGTGTTAAGTGTTACTCCCTCCGTTTCATAATAATGACTTACATTGTGAAACGGAGAAAGTAACGAA
AAGGGAAGACAGGTCGGCCGTACATAATCTGCCGCTAGCTTACCGAAGAATTAATTATAAGATGATCAATCAACTCTGCAGTCTAGCTAGTTGGAGAGAA
GAGATTATACTACTTTGTATCGTTAGAAATAAACAAAAGAAAACTACAAATTATATCTTTGACATGATATGGTTTGTCTCTGAGGTTCATAGCTACCACT
CGTTGTAAAGTGTCATCTAATTTAAGCTAATTTATGTTTAGCTAGTATACAAACACTGATCCCACTGTCGTTTCCAAACTGACCATGGTATGCTCAATCT
TGCGGGTAGCGGAGAAAATCGACCTCAAAATCACATCTGCAGACATCAGCTCGTGGTACTACGTCGGATCAGGTTATTTCTGATGGGTCCAAACCCTCAC
CTTTGATGAGTTTAGCCCTAGTCAGAGATTTCTGGTCACTGATGATTCCACTCATCTTTGACGGGGATAGCCTATCAGAGGTGATAGTCACATCTGACAG
GCCAGTATTTTCCGGCCATCAGAGGTGAGGGTCTCCGCAAGCCCAGGGGTGGTTACAACCCGTTAGAGGTGAGACGCATGTGACGGGTCCAAAGGTGACA
TCCCGTGTACCCATTCTATGACGTATCTACCTTGATGCCCGTCACAGATGACTCACCTATGACGGGTTGAAGTAGCACAGATGAGGTCACCTATGACGGC
CTTTGTTTATAACCCGTCAGTGATGAGGAACCGCATCGTCTTGGAGCTCATCGGAGACACTTCTCTCTTCTCCGATCTCCTTCAAAGTTGCTAGCATCCT
CTTGCAGTTGCATTGTGTCTCCATCACTTGGTTCCATTTTTTTGGGTGCAAATCTTCTTCTAATGCAACTACAGGTTCCTATTTTTGTAGGTGCCATATA
GATTATTCTCATAAATCTTCTCCTCAATCTGAATTTTCCTGTTCCTATTCGATATTCT