Detailed information on CNT30577867


BLAST search results

BLAST vs Swiss-Prot:
sp|Q7XHC4|AT15_ORYSJ, E-value = 2e-27

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30577867

Peptides detected in this lncRNA

>peptide 1 (46 aa)
CVNDILINLIVDKWHKLRGYMLTPGIVCLMDLFTYYDLRGIYISNR*

Sequence

>CNT30577867
TGCGTGAACGATATATTGATAAATCTTATTGTAGATAAATGGCACAAATTGAGAGGGTACATGTTAACACCAGGCATAGTTTGTTTGATGGATTTATTTA
CTTATTATGATCTGAGAGGCATATATATTAGTAATAGGTAGTTCGCAGAGTTAATTAGGTGGTGGCGTTGAGCTTGGCTATTTCTTGATGGAAGGCGTCG
GCATGGTGAGCTTTAACACAGCCTGACATCACCCTAGCTCCTTGTGGTGTGTTGTTGAGCATGAAGCAGATGGGCATTTTCTTGGAGAACACCTCCCTCT
GCGGGTAGGTCATCACCCTCGCCGTCTTCCCGCTGCCGAAATCGACGTCCTCGAACCCGATGTTTCGCCAGGATG