Detailed information on CNT30577866


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30640799Oryza barthiiNymphaea colorata14.9832.0685.25244reverse complement
CNT30550200Oryza barthiiIpomoea triloba15.2947.6197.19249reverse complement
CNT30730558Oryza barthiiCorchorus capsularis15.2926.6396.39249reverse complement
CNT30490117Oryza barthiiOlea europaea15.2920.3997.19249reverse complement
CNT30157615Oryza barthiiPistacia vera15.2933.9294.38249reverse complement
CNT30181978Oryza barthiiSecale cereale15.2928.1799.6249forward
CNT30297877Oryza barthiiTriticum aestivum15.2946.5499.2249reverse complement
CNT30221603Oryza barthiiHordeum vulgare15.2920.6698.39249reverse complement
CNT30386300Oryza barthiiTriticum turgidum15.2939.3499.2249forward
CNT30592527Oryza barthiiMusa acuminata7.6137.1397.58124reverse complement
CNT30543279Oryza barthiiBrassica napus15.2923.4596.39249reverse complement
CNT30438120Oryza barthiiAegilops tauschii15.2936.6299.6249reverse complement
CNT30242955Oryza barthiiAvena sativa15.2926.6999.6249reverse complement
CNT30661281Oryza barthiiTriticum dicoccoides15.1690.1599.19247reverse complement
CNT30211712Oryza barthiiHelianthus annuus4.5433.3397.374forward
CNT30689135Oryza barthiiTriticum urartu15.2925.199.2249forward
CNT30721940Oryza barthiiTriticum spelta15.2921.599.6249reverse complement
CNT30595572Oryza barthiiOryza meridionalis13.1424.9796.73214reverse complement
CNT30434643Oryza barthiiPapaver somniferum12.9528.3694.79211reverse complement
CNT3035439Oryza barthiiCucumis melo10.867.4394.89176reverse complement
CNT30331546Oryza barthiiDioscorea rotundata7.9230.9494.57129forward
CNT30113381Oryza barthiiFicus carica11.7242.8392.15191forward

Expression of CNT30577866

Peptides detected in this lncRNA

>peptide 1 (56 aa)
MKNKSTSQSPKALSFSGKGYALYLNVGRHSGILLFGTIPSEVMQSTWRGRFILFSR*

>peptide 2 (55 aa)
MNRLFVLFISRFLGKIFFHFLAENQLYPILVGLSPIATSHPRILPHTWVRSSKAC*

>peptide 3 (43 aa)
MLTSVQEQGRGLIANKMSGRRPSAFFLFDEKQIDISISESPFL*

>peptide 4 (29 aa)
MQXKNYPFLFVCPNETKKSLLLYHFRGWG*

>peptide 5 (38 aa)
MRQRRASFFTTLGDGGEGGFTYRDWVDIRNREEKRKQT*

Sequence

>CNT30577866
GCAGGATAGTAAAGAGCTGATTCTAGGGAAAGCTAGGNTTTCACTTTTCTCTCAGCCATCGAGTTGGAGTAGTTAACCATCTATATGCCGTGGAAGAATA
CGCATAAGCATTAGTTCTTGCCCTACCAAAATCATGCGATCATTTTTACCCGGGGTGAAGCCCTCCAAACTATTGATATGAACCAGGTGAATTGAGTGGT
TATGGTACAGGTCATGATATATGTTGCAATATGTGTTGTATTTACGAAGCGAATTTGTAAAGTTGTAAGATGAATCGCCTTTTTGTACTATTTATTTCAC
GGTTTTTGGGGAAAATCTTTTTTCATTTTCTCGCGGAAAACCAGCTATATCCGATCTTGGTTGGCCTTTCACCCATAGCCACAAGTCATCCCCGTATTTT
GCCACATACGTGGGTTCGGTCCTCCAAGGCCTGTTAGAGCTCTCTTCAACCTGCTCATGGCTAGATCGATCGGTTTCGGGTCAAATAGGAAGAACGTAAA
TCTTCCACCTCTGGAAAGCGCCTACACCTAATGGCTTAAGCCGCTGTTCCCATTTCCTCGCTGACCCATCATGCGAAAGACCAATAAAAAACTTCAACGT
TTCGTTGGTAGAATCCACGCCAACTCTTTTCTCTAAATAATAGAGAAATCTTTTGATAGTCTCACTTCTATCAATGCAATNAAAGAACTATCCCTTCCTA
TTTGTTTGTCCTAATGAGACAAAGAAGAGCCTCCTTCTTTACCACTTTAGGGGATGGGGGTGAAGGGGGGTTTACATACAGAGATTGGGTTGACATCCGA
AACAGAGAGGAAAAGAGGAAGCAAACATAGCTAGCTCACGAAAGAAAGCTTGCAACTACGNGTTATATATTTTATTTTCAANTNCGCTAATAAGGGCACA
TCCGCTTTCTCTGTATGTAGATTAAAAAAATACATACCATATTTTTTCCCTTGCTTTGCTATTTGAATGCTTACCTCAGTGCAAGAGCAGGGAAGAGGTT
TGATTGCTAATAAAATGAGTGGAAGAAGGCCGTCGGCCTTCTTCCTTTTCGATGAAAAACAAATCGACATCTCAATCTCCGAAAGCCCTTTCCTTTAGTG
GTAAGGGATATGCACTTTATCTGAACGTCGGCAGGCATTCCGGAATTCTCCTTTTTGGGACCATACCTAGTGAAGTGATGCAGTCGACCTGGAGAGGAAG
ATTTATCTTGTTCAGTAGATAGATGTATAACGCAACTGATTATGCTTTAACTACAGGTGCATACGGCCTTTCTTTTCTTCTTCAGGTTCAGTAATATCGT
AGATAGACATCTTGCTTTACATCTGGGTTTTGGTACGAAAGTGAAAAATCTTCGTCCTACCAAAACCGGATCTTGAAAAGTGTTCAGTGCCNAACACATC
GGTGAAACCGNGGAGAGCTGAAGAGAAGGNAAACCCCAGAGGCATTGATCATTTGGTACAGCCGCTAATTCGGCATTTGGTACTGCCACCATTTCTCGAA
AGGGAAAAAACATACTTAACAATTCGATTGGGAGGACCAAGGGATAGATCGATTGCAATATCANTATCATACAAATAGAAATAGACATGAGTACATGAAT
AAGGAAACGCAAAAGACACAGAGTAGGGG