Detailed information on CNT30577843


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT308847Oryza barthiiZea mays11.1337.8489.2984forward
CNT30720151Oryza barthiiTriticum spelta11.2621.9689.4185forward
CNT30371204Oryza barthiiOryza glumipatula79.7499.6799602forward
CNT30103707Oryza barthiiOryza rufipogon87.5531.2898.94661forward
CNT30117763Oryza barthiiOryza nivara100.2676.1698.68757forward

Expression of CNT30577843

Peptides detected in this lncRNA

>peptide 1 (78 aa)
FPLGSHPHHHPIPGTRPISASSFAFAASPLSHTCIAIAVIVRTKLCSASAPPPSCSRTRRRASHLISSADRSIRCRES*

>peptide 2 (41 aa)
MTHNRAVSYSLWGASVVVISLALALMNKKTLILNVIHTYVL*

>peptide 3 (43 aa)
LPPRLAPPPPPDSRNPPHFRLLLRLRGFASLPHMHRHRRHCQD*

>peptide 4 (49 aa)
MIFSFSVILLKIRSIICFVLFCTILFMPPHEKKKPHSDHTFEQETQREA*

Sequence

>CNT30577843
CTTCCCCCTAGGCTCGCACCCCCACCACCACCCGATTCCCGGAACCCGCCCCATTTCCGCCTCCTCCTTCGCCTTCGCGGCTTCGCCTCTCTCCCACACA
TGCATCGCCATCGCCGTCATTGTCAGGACTAAGCTCTGCTCTGCATCTGCACCACCACCCAGCTGCAGCCGAACAAGAAGACGAGCATCTCATCTCATCT
CATCTGCCGATCGATCGATTCGCTGCAGGGAGAGCTGAACAATGGAGTTCGTGTTGATCATCTCGCTGCCGCTCCTCATCCTGATCATAATCGTCGCGGT
GGTTCTCTGCATCATCTGCCGCTAGCTGAATGGTGACACCTCATTGTTCTTCTGGCCCATATCTTGATGTGAACATATCATGTATCAATTGATTAGTATC
TCATGACTCACAACAGAGCAGTCTCGTACTCTCTTTGGGGGGCCAGTGTGGTTGTGATTAGTTTGGCCCTAGCTTTGATGAACAAAAAGACATTGATTCT
GAATGTCATACATACATATGTGCTGTGAGAATCCCCTCTCTGCTTTGGTTCGTTTTTGATATTATTCATACGGGAGATCGGACAGCTGAAAGCATGATAT
TCTCATTCTCTGTCATTCTTCTGAAGATCAGAAGCATCATCTGCTTTGTGTTGTTCTGTACCATTTTGTTCATGCCGCCCCATGAGAAAAAAAAGCCACA
TAGTGACCATACTTTTGAGCAGGAAACGCAAAGAGAAGCCTGATGAGAAAGGAAC