Detailed information on CNT30577840


BLAST search results

BLAST vs Swiss-Prot:
sp|Q7XHC4|AT15_ORYSJ, E-value = 3e-40

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30577840

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MMSSRAGSHIHPDDGHRRAPVASSCRCRRSS*

>peptide 2 (36 aa)
MSLPPVILSCSGIRSLARRMMSTMSLMSAFATAPLFA

>peptide 3 (50 aa)
MNCLCVNDILINLIVDKWHKLRGYMLTPGIVCLMDLFTYYDLRGIYISNR*

Sequence

>CNT30577840
ATGAATTGTTTATGCGTGAACGATATATTGATAAATCTTATTGTAGATAAATGGCACAAATTGAGAGGGTACATGTTAACACCAGGCATAGTTTGTTTGA
TGGATTTATTTACTTATTATGATCTGAGAGGCATATATATTAGTAATAGGTAGTTCGCAGAGTTAATTAGGTGGTGGCGTTGAGCTTGGCTATTTCTTGA
TGGAAGGCGTCGGCATGGTGAGCTTTAACACAGCCTGACATCACCCTAGCTCCTTGTGGTGTGTTGTTGAGCATGAAGCAGATGGGCATTTTCTTGGAGA
ACACCTCCCTCTGCGGGTAGGTCATCACCCTCGCCGTCTTCCCGCTGCCGAAGTCAACATCTTCGAATCCGATGTTTCGCCATGATGTCAAGTAGAGCAG
GCTCTCATATCCATCCAGACGATGGTCATCGGCGAGCTCCCGTAGCATCGTCATGTCGCTGCCGCCGGTCATCTTGAGCTGCTCCGGTATCCGCTCCTTG
GCGCGCCGTATGATGTCTACAATGTCGTTGATGTCGGCGTTCGCCACCGCGCCGCTCTTCGCCAC