Detailed information on CNT30577733


BLAST search results

BLAST vs Swiss-Prot:
sp|Q7XXN5|PHT3_ORYSJ, E-value = 9e-92

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30300982Oryza barthiiTriticum aestivum27.3260.0588.84224forward
CNT30596889Oryza barthiiOryza meridionalis70.3769.2794.11577forward
CNT30105192Oryza barthiiOryza longistaminata18.2936.4196.67150forward
CNT30103255Oryza barthiiOryza rufipogon70.2471.3897.74576forward

Expression of CNT30577733

Peptides detected in this lncRNA

>peptide 1 (85 aa)
GLCIHPATERPLGDIEHACTAHKVHKDTFFFASCSRIKKQPYITYNSGKLKVDLSSNAQMHTATHTGIINILYNNNNNNNNRTIS*

Sequence

>CNT30577733
AGGTTTATGTATACATCCTGCAACAGAAAGACCATTAGGAGACATCGAACATGCATGTACAGCACACAAAGTACATAAAGACACCTTTTTTTTTGCTAGC
TGCTCACGGATTAAAAAGCAACCCTACATAACTTACAACTCCGGCAAATTAAAAGTCGATCTCTCTAGCAACGCACAAATGCACACGGCTACACATACCG
GAATAATTAATATACTGTATAATAATAATAATAATAATAATAATCGAACTATCAGCTAAGATCGATCGGTGTGCATAAACACGCGGAAATACGGTTCGGT
CGGTCGGTCGGTGTTCGCCATGCACGCAACCGTCGCATGCAACACAAAATGCAATATAGAGATTTAGGATAAAACTCGAGCGAGAGGCGAGAGCTAAGGT
AGAGAGCTACTCTATGGAGTAGCAGCTCTCCTTGAATGCCTCGAGGTTGTGGTTGAAGACGGGGACGAAGGCGTCGACGCTGCCGTCGCCGAGGTACGAC
GGCACCAGGAACAGCATCCCCTCCGTCGGAAAGTACGACGGCATGAAGTAGGTCGGGCAGCCGCCGCCGAAGTCGAGCTCGTAGAACGGGAAGGTGAGCC
AGCTGTCCACCTCGGCGTTCGGGCACAGCACGTCCTTGAGCACGGCGCTCGGCGCGAGCCCCTCCTTGTCGCCGCCGGCGCCGGAGAGGGCGAAGTCGAG
GAAGGAGCGGAAGTAGGCGCCGTCGACGCGCGCCACCTCGTCGTGGATCACCTGCGCGGCGTGCTTGAGCGGCCGGGTGAGGAGGTCGCCGACGGTGGCG
CGCGGGAACGCCCAGAGGAC