Detailed information on CNT30577689


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT007530, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520649Oryza barthiiSetaria italica24.6222.3389.71243forward
CNT30187028Oryza barthiiSecale cereale22.814.3592225forward
CNT30451372Oryza barthiiSaccharum spontaneum24.5215.6591.32242forward
CNT30371059Oryza barthiiOryza glumipatula50.5693.4599.2499forward

Expression of CNT30577689

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MDGIEHGPGPSPSCRFVAEEPINVLVAVALDDGISPYYSKER*

>peptide 2 (45 aa)
LTKFSTSINHHRSSSRLAVQKKSITDCDPVGSRNRVTLAMTRVYW*

Sequence

>CNT30577689
TTGACAAAATTTTCCACTTCGATTAATCACCACCGTAGTAGTAGCAGACTAGCAGTACAAAAAAAAAGTATTACAGATTGCGACCCCGTAGGTAGTAGAA
ACAGAGTGACACTGGCTATGACACGTGTATACTGGTAGTACTCACTATTACTAGTAACTGCACGCAGCGGCCAACCACTGGATGCGTCGTCACCGTTGCA
CAACGCTGGCCGTAGCTGTAATAACACGGTAACAGTAGGCAGGCTGCAGTTAATGAAACGAGACGCGAGCGATGGATGGGATCGAGCACGGTCCCGGCCC
CTCTCCGTCCTGCCGGTTTGTGGCGGAGGAACCAATTAACGTACTCGTGGCCGTAGCGCTAGACGATGGAATCTCGCCGTACTACTCCAAAGAAAGGTAA
AAAAGAAAAATGTAATCACCTCATCAATCCTCACTAGTGGCTAATTACTCACTGTAATAGTACGGTAGAATTCGAGTTACTGCGTGCGTGCGTGCGTGCT
AGTTGCGGTTGATGAAGGCGACGAGCGTGGCCATCTCGGCTTGCGCCTGCGGCGTGCTGAGCTTGGTGAGGAAGTAGACGTGGCCCTCGCCGGGGGTCTC
GTAGAGCTCGGCCTGCCCCGGCCAGCCGCTGCTCCGGAGCGTGGCGTAGTAGGCGCGCTGCCATGGGCTCAGGCGGTCCTGCTCCGACACGGTGACCAGC
ACGCGGGAGCAGCCGAGGCGCTGCCACGACGACGCCGGGAGCGCGAGAGGGTTCGCGTCGCCGTACTTCACCGACACGGCCAGGACGCCCGCCTTGGCCG
CGAGCGTGTTGAGGTAGGCGTGGTAGATGGGCGTGAACGCCGACTCGACGACGAACGCGCCGCCGTGGAAGTAAAGCAGAACCGGGACCTTGGCGGTGGC
GCGGAAGCTGGGGAGGTAGAGCCGCGCGCGGACATCGTTGGCCGGATCAATGGCGACGTCCCTGGACGACACGCCGGTGAGCACGTC