Detailed information on CNT30577638


BLAST search results

BLAST vs Swiss-Prot:
sp|Q07078|HSP83_ORYSJ, E-value = 7e-57

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695840Oryza barthiiOryza sativa46.343.699.67300forward
CNT30675663Oryza barthiiSetaria viridis23.6132.991.5153forward
CNT30378101Oryza barthiiArabidopsis thaliana37.3527.4485.54242forward
CNT30282434Oryza barthiiChenopodium quinoa36.429.6188.56236forward
CNT30381504Oryza barthiiManihot esculenta24.0718.285.9156forward
CNT30402836Oryza barthiiBeta vulgaris32.2521.6485.65209forward
CNT30631186Oryza barthiiVigna unguiculata44.7525.685.52290forward
CNT30712266Oryza barthiiGlycine max15.5936.8688.12101forward
CNT30635894Oryza barthiiCapsicum annuum33.1838.1988.37215forward
CNT3094731Oryza barthiiSolanum tuberosum29.9412.9286.08194forward
CNT30187559Oryza barthiiSecale cereale34.5733.5891.96224forward
CNT30298345Oryza barthiiTriticum aestivum37.0434.0990.42240forward
CNT30394033Oryza barthiiTriticum turgidum37.0417.7490.42240forward
CNT30560520Oryza barthiiActinidia chinensis26.3953.9483.63171forward
CNT30510308Oryza barthiiSolanum lycopersicum27.1668.2289.2176forward
CNT30554828Oryza barthiiOryza glaberrima63.4378.7498.54411forward
CNT30441217Oryza barthiiAegilops tauschii50.4644.0190.52327forward
CNT30250974Oryza barthiiAvena sativa20.9931.6394.12136forward
CNT30314068Oryza barthiiCamelina sativa49.8521.3184.52323forward
CNT304322Oryza barthiiZea mays39.9745.3686.87259forward
CNT30227528Oryza barthiiAnanas comosus38.7334.5386.85251forward
CNT30126131Oryza barthiiCorymbia citriodora25.3128.6780.49164forward
CNT30625469Oryza barthiiDaucus carota45.5219.7283.05295forward
CNT30352420Oryza barthiiEragrostis tef51.5453.9689.22334forward
CNT30477326Oryza barthiiArabidopsis halleri21.9116.0688.73142forward
CNT30362217Oryza barthiiSorghum bicolor20.2225.0586.26131forward
CNT30371090Oryza barthiiOryza glumipatula46.362.2499.33300forward
CNT30481150Oryza barthiiChara braunii32.721583.49212forward
CNT30704690Oryza barthiiPrunus avium45.2214.4284.64293forward
CNT3055965Oryza barthiiAmborella trichopoda33.1824.7486.05215forward
CNT30107297Oryza barthiiOryza longistaminata69.2910097.55449forward
CNT30323609Oryza barthiiAsparagus officinalis50.7719.7688.15329forward
CNT30149846Oryza barthiiBrachypodium distachyon38.5856.4387.6250forward
CNT30103353Oryza barthiiOryza rufipogon52.4733.8698.53340forward
CNT30584451Oryza barthiiEchinochloa crusgalli19.2923.3290.4125forward
CNT30594767Oryza barthiiEragrostis curvula14.5136.4389.3694forward

Expression of CNT30577638

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MSGGQSRRAASPGPSQTCRSCQHRHACGAHP*

>peptide 2 (97 aa)
MTTMALSRPPPSCSRRRRPPAAACQEGSLEEQHHQVLHRLVVLVSIGTLAELIHDGILRVDLHGLLARHVAGHAGVPQSLGLHDPLHVSSPAILPSD*

>peptide 3 (63 aa)
MLESLRAWAFMILSMLAVQPYSPVTRQQGESTTRSETTTFSTLSPSTSLITLHRPSNFSLSSSC

Sequence

>CNT30577638
ATGCAGAATCAAGAACAAAGAGTTACTATAAAAGGGCTAATGCAGAATAAGAAAATACAGATTCTGGATTAATTAACTAGCATATTTAAATTTAAAACGT
AACTGTTTGAGCAAATACCACGAAATGTTCAGGAGCTAAGATACGGCAATACCGATACATCCAGCATAGCAAAAATGGCGAAGAGCACAGAGTCAGATAA
AGCTATAGAGAACTAGGGCTCCAGGAGATGGGGGCCGAATGACAACCATGGCGCTTAGTCGACCTCCTCCATCTTGCTCTCGCCGGCGTCGTCCTCCAGC
GGCGGCATGTCAGGAGGGCAGTCTCGAAGAGCAGCATCACCAGGTCCTTCACAGACTTGTCGTTCTTGTCAGCATCGGCACGCTTGCGGAGCTCATCCAT
GATGGCATTCTCCGGGTTGATCTCCATGGTCTTCTTGCTAGACATGTAGCCGGCCATGCTGGAGTCCCTCAGAGCCTGGGCCTTCATGATCCTCTCCATG
TTAGCAGTCCAGCCATACTCCCCAGTGACTAGACAGCAGGGAGAGTCCACCACACGGTCAGAGACAACAACCTTCTCCACCTTGTCACCGAGCACCTCCT
TGATCACCTTGCACAGACCCTCGAACTTCTCCTTGAGTTCCTCCTGCC