Detailed information on CNT30577616


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30371049Oryza barthiiOryza glumipatula86.0410099.74382forward
CNT30117541Oryza barthiiOryza nivara88.2910099.49392forward

Expression of CNT30577616

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MNSGDAVLPIIDSRRHRGLPKMLGCPLRRRLFRCNVPSGCGPSVSHGFSDARSPWNGFETNRRRGRP*

>peptide 2 (30 aa)
MASPTHGRHGTDLRPTDDEEGHDKGMLDLL*

>peptide 3 (42 aa)
SRDISEMPWKSHRELNHHKRHRIIHLNRLLYILDIQLEEIGS*

Sequence

>CNT30577616
ATAGCCGCGATATTAGTGAAATGCCATGGAAATCTCACCGAGAGCTCAACCACCACAAGAGACATAGAATTATTCATTTGAATAGGCTTTTATATATACT
TGACATACAATTGGAAGAAATAGGATCATAGTAAGAGATTGAACAGGTGATCAACTGATCACTACTCTACAGCATAGAACTTCCGATGAATAGATGAATT
CCGGAGATGCCGTACTACCTATAATCGATTCAAGGAGACATAGGGGACTGCCAAAGATGCTCGGTTGCCCTCTGCGCCGGAGGCTTTTCAGATGCAACGT
TCCTTCAGGCTGCGGACCTTCTGTCAGCCATGGCTTCTCCGACGCACGGTCGCCATGGAACGGATTTGAGACCAACAGACGACGAGGAAGGCCATGACAA
GGGAATGCTAGACCTTCTGTGAGTCTTGCCTCAGATGGTGATGC