Detailed information on CNT30577582


BLAST search results

BLAST vs Swiss-Prot:
sp|Q76H85|H4_SILLA, E-value = 1e-39

BLAST vs NONCODE:
NONGMAT001327, E-value = 1e-35

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695897Oryza barthiiOryza sativa83.1889.6697.92529forward
CNT30670612Oryza barthiiSetaria viridis31.765098.51202forward
CNT30522839Oryza barthiiSetaria italica34.1237.0997.7217forward
CNT30317753Oryza barthiiCorylus avellana24.6922.5684.71157forward
CNT30375418Oryza barthiiArabidopsis thaliana10.0627.1287.564forward
CNT30617135Oryza barthiiSesamum indicum23.915.1585.53152forward
CNT3069058Oryza barthiiQuercus suber20.614.9782.44131forward
CNT3042757Oryza barthiiPrunus dulcis22.0123.182.14140forward
CNT30186872Oryza barthiiSecale cereale24.8431.6694.3158forward
CNT30286361Oryza barthiiTriticum aestivum35.6941.596.04227forward
CNT30220695Oryza barthiiHordeum vulgare24.8436.2498.1158forward
CNT30387206Oryza barthiiTriticum turgidum34.7539.6195.93221forward
CNT30565712Oryza barthiiActinidia chinensis30.564.8887.63194forward
CNT30554906Oryza barthiiOryza glaberrima71.0778.299.78452forward
CNT30434672Oryza barthiiAegilops tauschii35.6951.8396.04227forward
CNT30239976Oryza barthiiAvena sativa35.3844.6496.89225forward
CNT30664872Oryza barthiiTriticum dicoccoides35.0647.4594.17223forward
CNT3082467Oryza barthiiBrassica juncea24.8422.0481.01158forward
CNT30261175Oryza barthiiBrassica rapa22.9630.9380.82146forward
CNT30450127Oryza barthiiSaccharum spontaneum25.7924.5595.73164forward
CNT30143346Oryza barthiiLolium perenne34.4337.5692.69219forward
CNT3015042Oryza barthiiZea mays35.0637.6796.86223forward
CNT30229571Oryza barthiiAnanas comosus33.3351.4693.87212forward
CNT30685043Oryza barthiiTriticum urartu35.0650.1195.52223forward
CNT30348363Oryza barthiiEragrostis tef24.5328.0196.79156forward
CNT30620798Oryza barthiiCajanus cajan30.9737.7482.23197forward
CNT30596905Oryza barthiiOryza meridionalis78.6282.2495.4500forward
CNT30370989Oryza barthiiOryza glumipatula26.4226.88100168forward
CNT30645368Oryza barthiiCannabis sativa22.0142.384.29140forward
CNT30325970Oryza barthiiAsparagus officinalis21.5419.8685.4137forward
CNT30148852Oryza barthiiBrachypodium distachyon34.5949.5593.64220forward
CNT30103387Oryza barthiiOryza rufipogon58.0239.5999.73369forward
CNT30581397Oryza barthiiEchinochloa crusgalli34.9137.8298.2222forward
CNT30496126Oryza barthiiDigitaria exilis24.8423.2495.57158forward
CNT30117527Oryza barthiiOryza nivara70.2877.6100447forward

Expression of CNT30577582

Peptides detected in this lncRNA

>peptide 1 (36 aa)
LKTNWAIQVNQCHQLEQCRLQNVHIARQEIATEFRG*

>peptide 2 (35 aa)
MKQQLQEKRLGYYDELKNMALIESLSNRVASHRLA*

>peptide 3 (65 aa)
MRFTPPLLASLRIAGFVIPWMLSRSTFLCLFAPPFPSPLPPLPLPDIAAAAARRRSRGRNFDLVRS

>peptide 4 (32 aa)
AQNKLGNTGQPVSPTRTMQVAKRSHSTTRDCN*

Sequence

>CNT30577582
GCTCAAAACAAATTGGGCAATACAGGTCAACCAGTGTCACCAACTAGAACAATGCAGGTTGCAAAACGTTCACATAGCACGACAAGAGATTGCAACTGAA
TTTAGAGGGTAAATCACTGCAGATTTCCTATTCCATTCGAACGAACGAACCAGTAGTTCATACATCCCTAATTAATGAAGGAACAGGAGACGAGATGAAA
CAACAGCTACAGGAGAAGAGGCTAGGCTACTACGACGAACTGAAGAACATGGCACTAATCGAATCCCTATCCAATCGCGTGGCCTCGCATCGCCTCGCCT
AGCCGCCGAATCCGTAGAGGGTGCGGCCCTGGCGCTTGAGCGCGTAGACGACGTCCATGGCGGTGACGGCGTCGCGGATGACGTTCTCGAGGAAGATCTT
GAGCACGCCGCGGGTCTCCTCGTAGATCAGCCCGGAGATGCGCTTCACGCCGCCCCTCCTCGCCAGCCTCCGGATCGCCGGCTTCGTGATCCCCTGGATG
TTGTCGCGCAGCACCTTCCTGTGCCTCTTCGCGCCGCCCTTCCCGAGCCCCTTGCCGCCCTTGCCTCTCCCAGACATCGCCGCCGCCGCCGCTCGCCGCC
GGTCGCGAGGAAGAAACTTTGACTTGGTGAGAAGTG