Detailed information on CNT30577567


BLAST search results

BLAST vs Swiss-Prot:
sp|P36213|PSAD_HORVU, E-value = 7e-97

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695406Oryza barthiiOryza sativa73.784.9199.37636forward
CNT30554655Oryza barthiiOryza glaberrima83.3182.17100719forward
CNT30117304Oryza barthiiOryza nivara83.3179.5499.86719forward

Expression of CNT30577567

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MAMVVGGGERSVPCGGFDSSGVVWRRWSREKPKKKRGEMGEEVDKGI*

>peptide 2 (37 aa)
MSKTFLPVNLTSMGLTFLPMLRKFWPTPCLPALTFSG*

Sequence

>CNT30577567
AATATTATAAGAAGAGATTATATCCCACCATCGATCGATTACACCATCATCAATAACTGAAGAGCAGCCTGACAGATGATTAAAATTACATGTCCATCCA
CCCAAAACACAAGTAATTAATAGGTCGATTATGAGAGAAGAAGAAGAAGGAGAAGTCTAGATGTCGAAGACGTTCTTGCCGGTGAACTTGACCTCGATGG
GGCTGACGTTCTTGCCGATGCTGCGGAAGTTCTGGCCGACGCCCTGCCTGCCGGCGTTGACCTTCTCCGGGTAGACGCCGTCCTTGGGGTGGAGGTACTG
CACCTCGCCATTGGGGAAGACGCGGTAGAACTGGTAGTTGATCTTGTACTTGGAGCGGAGCCTGGTGCCCAGGGCCAGGCACTGCTCCTTCCTGGCCAGC
TTCAGCAGGTTGGGGCCCTCGCGCATGATGGCGGCGCCGCCCGTGGGCATCTCGAACACCTGCTCCTTGGGCGACGTCCATGTGATGACGTAGAACTCCT
CCACCTGCGCCTTCCGGAGGAGTCCCCCCGTGCTCCCGCCGAAGATCGGGGACGGCGTGTTGGGGTCCAGCTGCGGCGGCACGAACCCCGCGGGGGCTGG
CTTCTTCTCCTCCGTCGCCGCCGCGGCGGGCTGATCCTCCGCCGCCGCTCTGAGGGAGGTGGGTGCCCTCGAGGTGGCACTTGGCGGCGGAGGCTTGCGT
GGCCATGGCCATGGTGGTCGGAGGAGGAGAGAGGAGTGTACCGTGTGGTGGATTCGATTCGAGTGGTGTGGTGTGGAGGAGATGGAGTAGAGAAAAGCCC
AAGAAGAAGAGAGGGGAAATGGGTGAGGAAGTGGATAAGGGGATATGAGGTTGGCCAATGGCG