Detailed information on CNT30577556


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004999, E-value = 5e-75

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30577556

Peptides detected in this lncRNA

>peptide 1 (60 aa)
VGMRLFKSLNSSKIMIYMFVYFYVLFIWFLLVFLLVLRVSLSFPSFRRFACVPGVFKKIN*

Sequence

>CNT30577556
GTCGGAATGAGGCTGTTCAAGTCTCTAAATTCATCTAAAATTATGATCTACATGTTTGTTTACTTTTATGTATTGTTTATTTGGTTTTTATTAGTCTTCC
TCCTTGTTTTGCGTGTTAGCTTGTCGTTTCCGTCATTTCGAAGGTTCGCATGTGTGCCGGGAGTATTCAAGAAGATTAATTGAAGACCGATTATTGCAAG
GCAAGTCACA