Detailed information on CNT30577533


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554565Oryza barthiiOryza glaberrima77.2574.5599.551793forward
CNT30106321Oryza barthiiOryza longistaminata30.1657.4297.43700forward
CNT30103130Oryza barthiiOryza rufipogon99.8399.6699.142317forward
CNT30117498Oryza barthiiOryza nivara77.6874.9499.51803forward

Expression of CNT30577533

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MVVVAIWNCCQNYQVNNPCLIITRSDTSERSSTQMQQVNQWS*

>peptide 2 (40 aa)
MRQVYCTRKEVLTYTCSRTIYSVVCPAQSPTSSCSLSMLY*

>peptide 3 (37 aa)
MIYKFCSSTSSEHLLKLCTIAIFLFTTDEFFKGGQEC*

>peptide 4 (29 aa)
CLRTVYGSFSQDKGNWEDLCSCCLQCFGV*

>peptide 5 (39 aa)
MSPHCLWFFLSRQRELGRPLLLLPAVFWCIRSYLRSWSW*

>peptide 6 (47 aa)
HVSALSMVLSLKTKGIGKTFALAACSVLVYKELSEKLELVIHTLSML*

Sequence

>CNT30577533
CATGTCTCCGCACTGTCTATGGTTCTTTCTCTCAAGACAAAGGGAATTGGGAAGACCTTTGCTCTTGCTGCCTGCAGTGTTTTGGTGTATAAGGAGTTAT
CTGAGAAGTTGGAGTTGGTAATTCATACACTTAGTATGCTTTGATGTGAGAATCAAAGGGTGCAAGCCAAGGTCGCCATTGCAAATCGTGGTGTGAAAGG
AAGAGCTGAAGAAACCAGCTGTTAGCTTGGAGGAAAACGTGGGGCAGCTATGGTCTTGGAAGCTAGCTGATGGTGAAACATTACTTGTGAGATCAATCGA
AATATTTAACAGGAAAGCTGGCGTTTCTTTTTTATGAAATGATTATCATCCACAAAGCATGGTGGTAGTTGCCATTTGGAACTGCTGTCAGAATTACCAA
GTCAATAACCCATGCTTGATTATTACAAGAAGTGATACCAGTGAAAGATCAAGTACACAAATGCAGCAGGTAAATCAGTGGTCATAGGATCATATCGAGC
CAGGAACAAGAACATTTCAAGAAAGGCATGCATTCATATTTCTTAATTTTTTTTTGTTTCCTGGCTATCATAACTTTTGACATAGCTTGCTCCATTGAAT
GGTAATCTCGTGTTAGAAAGTATTCCCTCCTTCCATAAGTGGAAGGAGGGTGTATAGAAGCACTGTAACTATAGTTTGTCATTGCTGATGAGACAAGTAT
ATTGCACTAGAAAAGAAGTACTGACCTATACATGTTCCAGAACCATTTACTCCGTCGTTTGTCCTGCTCAATCACCCACCAGTAGCTGCAGTCTAAGCAT
GTTATATTAAAGTAACGAGAGAGAAACAAAGCAAAAAAGAAATACTCAAGTTGTTTTAGTTAACATCCTTACATTGCAAGTTGCGTGACGATACCACATA
TGCTACTTGCCTACTCCAATAAGACTGACTCCTTAAAGATGATTTCATAGTGAAAATTGACAGAACAATATTGTAGTCCATATGGCTCTGAATCTTCCCA
TTGTTCTTTTCATTTTGTAAGAACAAAAGGTTGCTGTATATTCAATTAGTAAGCAGCTCAACTAGAATCCAATATTTCATTTTTTTCCCACACTTAATTT
CATTGTATAATCGTTATCTTATACTTTTCTTGTTTATTGCATGATATACAAGTTTTGTTCATCGACATCTAGCGAGCATTTGCTAAAACTATGCACAATT
GCTATTTTCCTATTTACTACTGACGAGTTCTTTAAAGGGGGCCAAGAATGCTAAATATGGTTATGAGAAGGAAAAGAGAGTGATCCATGGAACATAGCTT
GGTAGGCTGAATCCAAAGAATAGGAGACATTAGATGTTCATTTTTAAAAGAAAGGAGCTTGAAGCTGAAATGTTCATACTTATTGCCAGATTCCCATATA
TCCCATGACGACTGCAGTAGGCAAGCCACCATAGAATCTTCTTGATCCATGCCATTGCTTAAAGGCCTCAAAGACAAACGTGTTCTCCAGATTCTTCTTG
CTGACTATAGCTCACCAAATTTGGGTCTATGATGAATGATTGAATTCTCCAACCAATTAAGAGCTTCTAGTAGTTAAATTAAACAACTCATCAAGGTACT
GACTAATGTTCAACTCACTCATTGACAAAGGCTCAAGGCATTTGGTAGTAGTTTGCTGTGATGTTTGGTTAGCTAACCTTTCCTAGCTACAAGATACTAA
TCAAGCATCAATATATTAACCATTGGGTTCAATGTGTCTCCATCAGACGAACCAACGAGCGCCTATGCTGCCGTTGAATCACTATCGCTGATGCAAGCTA
TAAGCTACTTGCCCCCGAAATAATGGAGTATCAGCTGTGATATTGCCGCCCGTCCGAAAAAAGATACAAAATTTTCCAACTACCATAGTTGTTGATACAA
GGAAACAAAGGGCCTATTTGGGGAGCTTCTAGCTGCTGCAGCTTCTCCCATAATCAGAAGCTCCCCCAAACAATCCAGCTTTTGGTCTAGATTCTGAGAA
GCTGTAGTTGTAAAATCCAGGAAATGAACTAGAAGCCAGAAGCTGTAAAACCTAGCTTTTCCAGATTCTGAGAAGCTGGCTACCAACCAGCTGCTTCTCA
GAATCTTAAGCTCCCCCAAACTCTGGCTATAGTTGGACTTGAAAACTCGGGCTCTGGCCTCTGGCAATAAAACAGTATGTAGAAACTTTTGAAGATTCTC
AAGAAGTTATGAGAACTGGGGAAGGTGATATTGCACAATTATGTAAAATTTGAAACGCGGACTTGATTTCATCTGTAAGATAAAAAAAATTCCTTGCCTC
GCCAGAGAAAATGAGTTTGAT