Detailed information on CNT30577521


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30596779Oryza barthiiOryza meridionalis53.0410098.6358reverse complement
CNT30105381Oryza barthiiOryza longistaminata54.3747.3598.91367forward
CNT30117421Oryza barthiiOryza nivara83.8549.6199.82566forward

Expression of CNT30577521

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MMSQKNPIVKLRLLPYTPHQKQLPLFVVFYES*

>peptide 2 (95 aa)
MIHLQQALIYHHDESEESDCQVTPSTIYSPPKTATTVCCFLRILSYLYGEKAVTMLKDGFEGTTRHASSYNRAVTRIQASKTLGRLSFRRCQHNA*

>peptide 3 (38 aa)
APATRRAMPPLLRPPDLGFYWSRRAQRPADHGRGRGDQ*

Sequence

>CNT30577521
GCCCCCGCTACCCGCCGCGCGATGCCCCCTCTTCTCCGCCCGCCTGATCTAGGGTTTTACTGGAGCCGCCGCGCGCAGCGACCAGCCGACCACGGACGAG
GACGAGGGGATCAGTGATATAGGAGATGATTCACCTTCAACAAGCTCTCATTTATCATCATGATGAGTCAGAAGAATCCGATTGTCAAGTTACGCCTTCT
ACCATATACTCCCCACCAAAAACAGCTACCACTGTTTGTTGTTTTCTACGAATCTTGAGCTATTTGTATGGAGAAAAAGCAGTGACAATGCTAAAAGATG
GTTTTGAAGGCACTACAAGACATGCCTCAAGTTATAACCGTGCTGTTACGAGGATCCAAGCATCCAAAACACTTGGAAGATTAAGCTTCAGGCGTTGTCA
ACATAATGCATAATTAGTTGCATACTTGCGTTGTAAGTTGTAACAGGGAGCTTTGCTCCAGTAACTCAGTATCATTGTCCAATAAATCTCACTTAGAAGT
TAGAATGTGCATTAGGTGTGTGGTCGACTCAGCACTTAACATGATGTAATCAGTTGGAACTCAATTCAGTACCTGTTCCTATTAAATTGATTTATTAAAC
GTTTGTTCATGCATTTGTTACAAAACTGAGTAATTTTTGTGCTCCCAAAATACATTCAGTGGATGATTGAACGGG