Detailed information on CNT30577520


BLAST search results

BLAST vs Swiss-Prot:
sp|A0A0P0XBU0|CCA1_ORYSJ, E-value = 3e-120

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695228Oryza barthiiOryza sativa30.8923.299.55223forward
CNT30675881Oryza barthiiSetaria viridis33.5223.3187.19242forward
CNT30523672Oryza barthiiSetaria italica25.6219.0984.86185forward
CNT30689302Oryza barthiiTriticum urartu24.2418.2186.29175forward
CNT30103059Oryza barthiiOryza rufipogon24.7956.2999.44179forward
CNT30497933Oryza barthiiDigitaria exilis47.2332.0584.75341forward
CNT30117398Oryza barthiiOryza nivara27.0134.15100195forward

Expression of CNT30577520

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MPCWEESQRGFLEHSQKDFLDLDQEYCRLL*

>peptide 2 (52 aa)
MKSDPAFSYFQKRHLFQLLRQVWCRPYLLEISLTQCGATLLLFHSHQSLKTL*

>peptide 3 (30 aa)
MTFIASELSCFRVSCNSFCALSIGQSISFS*

>peptide 4 (68 aa)
MLQAWQLHGLQGLTTMWRQACWRRWMTYWQKICRHLGCSGIASLVQRLHSCEERAVLRHCRRILDPQEV

Sequence

>CNT30577520
CCTTGTCGTTAGCCTTTTCTTGATTCTCAGGAGCATTATCTGCTTCTATATCACTACTTGACGGTGTGTTGGAACCACATGAAGAGCGATCCTGCTTTTT
CTTATTTCCAAAAACGTCACTTGTTTCAGCTCCTGCGGCAGGTTTGGTGTCGGCCTTATCTGCTGGAGATATCTTTAACTCAGTGTGGAGCGACACTTCT
CCTTTTCCACTCTCATCAGTCTCTGAAGACACTATGACCTTCATAGCTTCAGAATTATCTTGTTTCCGAGTTTCTTGCAATTCCTTCTGTGCATTATCCA
TTGGGCAGTCTATATCTTTCTCTTGAGCTCGCTGAACATCTGCTGAAAAAGAGGGAGAAGACCTTGTGTTGCCCACCATGCTGATGCTGCAGCAACTGTA
GCTGCGACAATAGATGCCATGTTGGGAGGAGAGCCAGCGTGGCTTCCTTGAGCACTCTCAGAAAGATTTTCTTGATTTGGATCAGGAGTATTGCCGTCTA
CTGTAGGCCAGTACGATGCTGCAAGCCTGGCAGCTGCATGGATTGCAGGGTTTGACAACAATGTGGAGACAAGCATGCTGGAGAAGGTGGATGACATATT
GGCAAAAGATCTGTAGGCATCTTGGTTGCAGTGGCATTGCATCATTGGTGCAAAGGCTGCATAGTTGTGAGGAAAGGGCTGTGCTGCGGCATTGCCGTCG
AATTTTGGATCCACAGGAAGTG