Detailed information on CNT30577505


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006488, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30103901Oryza barthiiOryza rufipogon30.45490.68601reverse complement
CNT30116877Oryza barthiiOryza nivara57.9248.4698.781145forward

Expression of CNT30577505

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MLYIMKFVGAGSLESFGWFNRIIITPLIP*

>peptide 2 (58 aa)
MLYFRITLWGLKMIFNAFKHCYMRLWKDTLNIILCDLLFKHLYKLRNPVKMGIFECYI*

>peptide 3 (47 aa)
MVFSVLQTILIVWVKLDSLCRGELNHSNVPYSRFWSCVIRVIPTXEV*

Sequence

>CNT30577505
AAATTATCCTTTAATTTCTTTAAATACCCTTTTCTTTTACCATTTTAAATTCTATTTCTTTAATCTATTTTAAAACCCCCTTTTGAATTCAAATTTATTT
GATACTTTTTTTTAAAAAAAACCATCCCTTAGCCACCAAATAACTGCCTTGGAACTTTACTCCTTCCATGGAGACGTTCGCGTGGTCTTACACCTCGACG
TCAAACCGTTGGTCGTAAAACCCGGCATCACCTAATCCTAAGGTTGAAGTGTCGCTCTTCGCACCCCACGCCTCAAGCCCTCAACGCTTACAGTGGTCAG
AGCCTCACTACTCTCTCGACCTCCACAGCACGCCGCACACTAGTCCTTGAGCTATGTGCGACCCTAGCCGCTCTGTTGTCACTCATGACTGCAGAGTAAC
ACTGTTCCCCTCCACACAAATCTCCTAACTCACTAGTCGTTGTGCTACTTAGCTGTAGCATTGACTAGACGAGCTGATATTTAGCCGTTATGCTACCCAT
CTTTAGCATCGGCTAACTAATCCAAATATCTAGCCGTCGTGCTACCCTACCCTAGCATCGACTAGAAACCAATCCACCAAATAAACCCCACCTATCCAAA
ATTATCCTTTCTTCGATTTTATTCAATTTCCAACCTATAGAAACCATCACCTCTCTTTTCTTCTTCAAGTTAAAAGTTTATTTTTAACCCATTTCCTTTT
TCCTCTCGCCTCGCTCCAATTTTATTTATTTCTTGGCTTTATCGTTTCTTTGTAGCAATTTGCTTATAGGCTTTATTTGCTATCTTTTTCGTATTCGTAC
GTTAGACCGTACAACAAGTTCTATCGGCATCCAAGGAGCTGACGTGGACCCAGATGGCTACGCTGAAGCCGCAGGAAATCTTAAGGCGCAAGGCAAGACA
TAACTAAAATTTTGATCATATAGAAAACTTGATATAATCTTCATATTTAAATTTGATGCATGATATTTACTGTTTTAACATCTCATGGGTAGATGTTATA
CTTCAGAATAACATTGTGGGGGCTTAAAATGATATTTAATGCTTTTAAGCATTGTTATATGAGATTATGGAAAGATACACTAAACATCATTTTATGTGAT
TTATTATTCAAACATCTTTACAAACTTAGGAATCCGGTTAAAATGGGTATTTTTGAATGTTATATATAATGAAGTTTGTTGGTGCGGGGAGTTTGGAAAG
TTTTGGGTGGTTTAACCGGATTATAATTACCCCCCTTATACCATGAGAAGTGACATAGTTGCGTCCATCCACATGACAAGTAATTGGACTTAGCCTAGTA
CATTGTCCCACTATATGAAAGACTGTTGGGTGGCTCTATGAGCGGTTGGGGTGAACATGCGTAAGGAGTTAGGGGGCAGTGTTTCACAACAGTGGGATTC
ATGAAAGTGTGACGATATAGATACCTTGTCTTAGGCCTGGCAAGAGTTCGACCACTATGATGAACCAACACCCCACTGTGCAGTAACTAGTAGTAAGTGG
GACTTTCGAACGGCTATGGTGTTTTCAGTCTTGCAAACTATTCTTATCGTGTGGGTAAAGCTGGACAGTCTCTGTAGAGGTGAATTAAATCATTCGAATG
TGCCGTACTCCCGGTTCTGGAGTTGTGTCATCAGGGTGATTCCTACTCNTGAAGTATAAGTAGTTTTAAAATTTAAGTTTTGAGGATAAGATTNATATAT
GATTTTATTACTCATTTACTTTCTTATTGATTTATGTATTCATATCTCTTCACCTTAATTATTTATAATATGTCTTGCTGAGTACATAAGTACTCACCCT
TGCATAATTTGACATATAGTTAAACTAACAAGAANTCTGGAAGGAAGCGAGATCTACGGCAACGACAAGTTTTTCTTCTAGGCTANTCTACACTCGAGCT
TTTGCCTGTGGAGTTCTTTGAAGTTGTTTGGAGTTTATTAGTTGTAGTTTTAGTAGTTGAAGAGCTTAGGAGTTTAG