Detailed information on CNT30577449


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695806Oryza barthiiOryza sativa81.4895.0998.031219forward
CNT30107123Oryza barthiiOryza longistaminata32.8954.8598.78492forward
CNT30117429Oryza barthiiOryza nivara100.2791.3598.21500forward
CNT30604504Oryza barthiiOryza punctata35.2925.7690.53528forward

Expression of CNT30577449

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MYYALPMQFVASSWAPCVLILGRKIELTNLGVQNSQKKKT*

>peptide 2 (67 aa)
MLNNIFCVLSSCKVDVHRQLHQIYNIPYHITVKRRRSQGMAEVALDESWSDKPPRQTWIQFRSGRSV*

>peptide 3 (29 aa)
MCMHSCWLKEIIQGDMMPKQEDRGQGCSR*

>peptide 4 (40 aa)
MNAILASIAQVDSGDILEKKKSIVVMRKAQEDKRTSEAAS*

>peptide 5 (39 aa)
MPAGKVISASFLVKMGRYVARAEFGNSKPLLVNSREIFI*

>peptide 6 (48 aa)
VYLLIDGFISPCICELWRLQQLWEENECMLLLEEPVVLMIVRMDGCER*

Sequence

>CNT30577449
TGTGTATCTGTTGATTGATGGATTTATCTCTCCCTGTATATGTGAGCTTTGGCGTCTACAGCAACTATGGGAGGAAAATGAATGTATGCTGTTACTAGAA
GAACCAGTAGTACTAATGATAGTGAGGATGGACGGATGTGAAAGGTAAAGTAATAACTTCTGTTGTGGTGATGGAGATGGATGCACCATTATATACAAGC
GAGGCTGGGTGGCTATGACGTTACATAGTTATGGATCTTGTTTTATAGTTGATCATGTATATTAACGGCTAATCAGTTGATTTTAATATGAAAAGTAGAG
AGGGGGGTGATCAAGTGGAGCATGGGATAACTACTGGGTGATGCATTAGTTCAGCTAAGTTGAGTGGGGCACGTTTGGAATGACTTGGCACATGCTTGCT
TGCTAACTTATGTAATTCGTGGGTATCCTCATAGTTAAGCTATGTTTCACTTGAGGTATGCCTGCAGGTAAGGTAATTTCTGCTAGCTTTCTTGTAAAGA
TGGGAAGGTATGTAGCTAGGGCTGAGTTTGGGAACTCCAAGCCTCTTTTAGTAAATAGTAGAGAGATATTTATTTAATTCCTGAAAAATTGTGTGAAGTG
AGAGTTACTAGTAGTGCCTGCAGGTGATATATGGCATAAGTAACCCAACAGGTGACAAGTAACCCCCGTTATTCTTGTAATGTATTATGCTCTTCCAATG
CAATTTGTTGCTTCATCTTGGGCCCCCTGTGTACTCATCCTTGGTAGAAAAATAGAGCTTACAAACTTGGGAGTTCAAAACAGCCAAAAAAAAAAAACTT
AGCTAGCTAGGTGAAAGTAATGCTTAATAATATTTTTTGTGTATTGTCCTCTTGCAAAGTTGATGTGCACAGGCAACTGCATCAGATCTATAACATACCC
TACCATATTACAGTGAAACGGAGGAGATCTCAGGGAATGGCTGAAGTTGCATTGGACGAATCTTGGTCCGACAAGCCTCCAAGACAAACTTGGATTCAAT
TTCGTTCTGGCAGATCGGTATGAATGCCATCCTCGCAAGCATTGCGCAAGTTGATAGTGGTGATATTCTTGAAAAGAAAAAATCGATAGTGGTGATGAGA
AAAGCACAGGAGGACAAGAGGACAAGTGAGGCGGCAAGCTAAGAAGACGGTGGCTTGGCGTGCTTGGCGTAATCTAACTTGATTACCAGGCAGAGGCAGA
CAAACACTGGATTCTAGCTCGATGGAAGATGTTCCTGCCACATGTGCATGCATTCATGCTGGCTTAAGGAAATTATTCAGGGAGACATGATGCCCAAGCA
AGAAGATCGAGGGCAGGGCTGCTCCAGATGAGATCATCAGCCGCAGCTACACCTCTACCTCTGCTTCTTGTTTTCCTCTACCTGTAGGCTGTAGCAACAA
GAAGTTTTCCTCTACCTGTAGGCTGTAGCAACAACAATAGTACTACTGCTCTGCTTCCTGTGTGTCATCTGCATCAATGATCTGTGATGATCTATT